Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV4460YP_366191.1putative oxidoreductase

XCV4460
XCV4459
XCV4459
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV4461
XCV4461
ID
AC YP_366191.1
LT XCV4460
SY
OR NC_007508 from 5142363 to 5143409 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 348 aa
 
........10........20........30........40........50
| | | | |
MVDDATPSRTTPAMKAIAYPQHGLPIDDARVLIELELPLPTPGPRDLRVR
IHAVSVNPVDTKVRSNAAVDAPRVLGWDASGVVDAVGEAVSLFRPGDAVY
YAGALTRPGTNAEFHLVDERLVGRKPATLDDAAAAALPLTAITAWELLFD
RLGIAEGGGEGQALLVVGAGGGVGSILVQLARTLTKLTVIGTASRPETQD
WVHALGAHHVIDHSQPLGEGLQRIGIAQVQHVASLTHTDQHFAQLVEVLA
PQGQLALIDDPATLDALPLKRKSVSLHWELMFTRSLFETQDMIAQHHLLN
RVAELVDTGVLRTTLGEHYGRITADNLRRAHAALESHRTRGKLVLEGF
xansp

YP_362772.1 lcl|XCV1041

14

217

S=396 I=44 E=2.22871e-41

putative oxidoreductase

xansp

YP_362771.1 lcl|XCV1040

234

348

S=267 I=50 E=9.27657e-26

hypothetical protein

pubmed

14

348

S=743 I=47 E=2.46295e-81

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

14

345

S=433 I=31 E=7.95379e-44

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

14

346

S=193 I=29 E=9.00382e-15

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

8

345

S=179 I=27 E=5.61346e-13

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

14

122

S=150 I=34 E=1.80108e-09

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

33

116

S=142 I=38 E=1.49849e-08

Zeta-crystallin

Pubmed 16978188

 

prodomImg

pubmed

14

120

S=138 I=35 E=4.3035e-08

NADPH:quinone reductase-like protein

Pubmed 17086451

 

prodomImg

pubmed

14

122

S=138 I=34 E=5.03476e-08

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 7476124

 

prodomImg

pubmed

14

122

S=137 I=34 E=6.3711e-08

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

14

116

S=133 I=34 E=2.06725e-07

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 8170370

 

prodomImg

sp

14

345

S=439 I=31 E=1.06077e-44

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

14

345

S=436 I=31 E=2.0222e-44

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

14

345

S=436 I=31 E=2.0222e-44

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

sp

14

345

S=436 I=31 E=2.09397e-44

Zinc-type alcohol dehydrogenase-like protein SAR2277 - Staphylococcus aureus (strain MRSA252)

 

prodomImg

sp

14

345

S=434 I=31 E=4.39362e-44

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

trembl

14

348

S=1419 I=84 E=1.9843e-162

Oxireductase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

348

S=1331 I=75 E=1.04041e-151

Putative oxidoreductase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

14

348

S=1319 I=77 E=2.98544e-150

Bifunctional oxidoreductase/alginate lyase - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

14

169

-

Iprscan IPR002085 [PTHR11695]

31

346

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

31

346

-

Iprscan IPR013149 [PF00107]

160

298

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

44

125

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

15

348

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR002364 [PS01162]

161

182

Quinone oxidoreductase/zeta-crystallin, conserved site

Iprscan IPR011032 [SSF50129]

14

157

GroES-like

Iprscan IPR016040 [SSF51735]

133

313

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4437fKXR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits