Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV4223YP_365954.1FecR family transmembrane sensor protein

XCV4223
XCV4222
XCV4222
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV4224
XCV4224
ID
AC YP_365954.1
LT XCV4223
SY
OR NC_007508 from 4849145 to 4850221 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE FecR family transmembrane sensor protein
IP ATPase, F0 complex, subunit A; Fe(2+)-dicitrate sensor, transmembrane component
CL
EC
GO Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Cellular Component: proton-transporting two-sector ATPase complex (GO:0016469)
Cellular Component: membrane (GO:0016020)
PM
AN
SQ 358 aa
 
........10........20........30........40........50
| | | | |
MVVSVASLAARRLTEEAAHWHALQRMQPLDADQQARFMDWLTASPAHVRE
YLAVTQVAGALGEALDAMALDVDTLLQADRQHDTGTARNVIALPLPPRRT
VAARGTARSQSAARRPHWHVGLAAMLGLLTVLGSWAWPRTSTYATAHGEQ
RRVQLADRSVVFLNADTRIQATMTPWSRRLQLLQGQASFAVAADRRPLQV
RALDLRVEDIGTAFDIALHGQQARIDVSAGRVHVWRADRPAQPMLANLGA
GQSARIDEAGQVALSNEDVATMHAWQQQRIVFRDEPLRNVAEDFNRLNRI
QLHIDDARAGAMRLTGNLRSDDLAGLRAFLAQQPGLRLEQHADALHIVGG
APPATTNW
pubmed

143

341

S=199 I=34 E=2.05372e-15

PupR protein

Pubmed 8026465

 

prodomImg

pubmed

143

339

S=141 I=27 E=1.95466e-08

FecR

Pubmed 11553538

 

prodomImg

pubmed

143

339

S=141 I=27 E=1.95466e-08

Transmembrane signal transducer for ferric citrate transport

Pubmed 18039831

 

prodomImg

pubmed

143

339

S=141 I=27 E=1.95466e-08

Protein fecR ; Ion transport Iron Periplasm Sensory transduction

Pubmed 2254251

 

prodomImg

pubmed

143

349

S=126 I=26 E=1.27294e-06

Transmembrane sensor (Probable transmembrane sensor)

Pubmed 8633080

 

prodomImg

pubmed

153

325

S=123 I=28 E=2.93975e-06

Putative inner membrane sensor

Pubmed 11292812

 

prodomImg

pubmed

127

344

S=122 I=26 E=3.85206e-06

FpvR

Pubmed 15743962

 

prodomImg

pubmed

127

344

S=121 I=26 E=5.65326e-06

FpvR

Pubmed 15743962

 

prodomImg

sp

143

339

S=141 I=27 E=1.24081e-08

Protein fecR - Escherichia coli (strain K12)

Pubmed 2254251,

 

prodomImg

trembl

3

357

S=1636 I=94 E=0

Transmembrane sensor - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

16

347

S=391 I=35 E=7.325e-38

Putative transmembrane FecR sensor protein - Stenotrophomonas maltophilia (strain K279a)

 

prodomImg

trembl

13

347

S=364 I=33 E=1.48056e-34

Putative FecR - Stenotrophomonas maltophilia R551-3

 

prodomImg

Iprscan IPR012373 [PIRSF018266]

10

352

Fe(2+)-dicitrate sensor, transmembrane component

Iprscan IPR006860 [PF04773]

141

233

FecR protein

Iprscan IPR000568 [PS00449]

309

318

ATPase, F0 complex, subunit A

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2AV5l9LZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits