Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV4186YP_365917.1xanthomonadine biosynthesis acyl carrier protein dehydratase

XCV4186
XCV4184
XCV4184
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV4187
XCV4187
ID
AC YP_365917.1
LT XCV4186
SY
OR NC_007508 from 4797139 to 4797426 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE xanthomonadine biosynthesis acyl carrier protein dehydratase
IP
CL
EC
GO
PM
AN
SQ 95 aa
 
........10........20........30........40........50
| | | | |
MDFVVPHDHPCLPGHFPGRPVVPGVVVLDHVLQAVEALHGPRAAMRLPQV
KFVQPLLPGQTASVTLEGDGPRWRFRVQRAEALLVSGELVAEAAA
pubmed

1

95

S=363 I=78 E=2.80057e-36

Putative dehydratase

Pubmed 12057948

 

prodomImg

trembl

1

94

S=382 I=84 E=9.52573e-38

Dehydratase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

94

S=368 I=79 E=4.94521e-36

Putative dehydratase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

95

S=363 I=78 E=2.27417e-35

Putative dehydratase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HrkcH54O)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

15 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits