Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3949rpoHYP_365680.1RNA polymerase factor sigma-32

rpoH XCV3949
XCV3948
XCV3948
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3950
XCV3950
ID rpoH
AC YP_365680.1
LT XCV3949
SY
OR NC_007508 from 4532987 to 4533871 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE RNA polymerase factor sigma-32
IP RNA polymerase sigma factor RpoH, proteobacteria; RNA polymerase sigma-F type; RNA polymerase sigma-70
CL
EC
GO Biological Process: transcription initiation (GO:0006352)
Biological Process: response to heat (GO:0009408)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: sigma factor activity (GO:0016987)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 294 aa
 
........10........20........30........40........50
| | | | |
MVPMNQTTSTALVANNLPIPSALGSLDAYIGAVHQIPVLSVDEEQDLARR
FRDELDLDAARELVHSHLRFVVHVARGYNGYGLPLGDLIQEGNIGLMKAV
KRFDPDMGVRLVSFAVHWIRAEMHEFILKNWRIVKVATTKAQRKLFFNLR
KSKTRLGWLNASEVTAVAKDLNVSEREVMEMESRLSGRDIGFDASSDEDD
DHGPPSPVSYLVANEEDPSQAYERHDSEDNQLQLLREGMAGLDARSRDIV
KRRWLDSDSKVTLQELADEYGVSAERIRQIEANALKKMKALFVA
xansp

YP_365643.1 lcl|rpoD-XCV3912

59

289

S=239 I=30 E=1.54883e-22

RNA polymerase sigma factor RpoD

pubmed

4

294

S=1509 I=98 E=3.10018e-174

Heat shock sigma factor 32 (RNA polymerase sigma-32 factor) ; DNA-binding Stress response Transcription regulation

Pubmed 9535756

 

prodomImg

pubmed

9

294

S=864 I=59 E=3.83943e-96

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 11320135

 

prodomImg

pubmed

19

289

S=858 I=62 E=2.35429e-95

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 11430412

 

prodomImg

pubmed

15

289

S=846 I=60 E=6.75561e-94

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9168128

 

prodomImg

pubmed

24

289

S=843 I=59 E=1.5876e-93

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 7501460

 

prodomImg

pubmed

14

293

S=840 I=56 E=2.9742e-93

RNA polymerase sigma factor ; DNA-binding Stress response Transcription regulation

Pubmed 16362517

 

prodomImg

pubmed

9

292

S=839 I=58 E=4.14245e-93

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 10492171

 

prodomImg

pubmed

23

290

S=831 I=60 E=4.06745e-92

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2841288,6088062

 

prodomImg

pubmed

16

290

S=823 I=59 E=4.13554e-91

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 2664713

 

prodomImg

pubmed

24

289

S=806 I=55 E=3.8842e-89

RNA polymerase sigma-32 factor ; DNA-binding Stress response Transcription regulation

Pubmed 9079916

 

prodomImg

sp

15

289

S=846 I=60 E=4.25704e-94

RNA polymerase sigma-32 factor - Vibrio cholerae

Pubmed 9168128,

 

prodomImg

sp

24

289

S=843 I=59 E=1.00043e-93

RNA polymerase sigma-32 factor - Proteus mirabilis

Pubmed 7501460,

 

prodomImg

sp

24

290

S=838 I=60 E=3.60414e-93

RNA polymerase sigma-32 factor - Haemophilus influenzae

 

prodomImg

sp

23

290

S=831 I=60 E=2.5631e-92

RNA polymerase sigma-32 factor - Escherichia coli (strain K12)

Pubmed 2841288,6088062,6387714,8041620,

 

prodomImg

sp

23

290

S=831 I=60 E=2.5631e-92

RNA polymerase sigma-32 factor - Escherichia coli O6

 

prodomImg

trembl

1

294

S=1550 I=99 E=2.43718e-178

RNA polymerase sigma-32 factor - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

4

294

S=1530 I=100 E=5.19502e-176

RNA polymerase sigma-32 factor - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

4

294

S=1523 I=99 E=3.75945e-175

RNA polymerase sigma-32 factor - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR000943 [PR00046]

242

254

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

262

277

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

277

288

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

87

100

RNA polymerase sigma-70 factor

Iprscan IPR011991 [G3DSA:1.10.10.10]

224

289

Winged helix repressor DNA-binding

Iprscan [G3DSA:1.10.601.10]

28

132

-

Iprscan IPR007627 [PF04542]

63

133

RNA polymerase sigma-70 region 2

Iprscan IPR007630 [PF04545]

238

290

RNA polymerase sigma-70 region 4

Iprscan IPR012759 [TIGR02392]

24

294

RNA polymerase sigma factor RpoH, proteobacteria

Iprscan IPR014284 [TIGR02937]

58

292

RNA polymerase sigma-70

Iprscan IPR000943 [PS00715]

87

100

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

262

288

RNA polymerase sigma-70 factor

Iprscan IPR013324 [SSF88659]

200

292

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013325 [SSF88946]

19

133

RNA polymerase sigma factor, region 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aJA0xKFc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

323 hits
swiss-prot

Swiss-Prot ncbi-blastp

126 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits