Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3938sppAYP_365669.1protease IV

sppA XCV3938
XCV3937
XCV3937
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3939
XCV3939
ID sppA
AC YP_365669.1
LT XCV3938
SY
OR NC_007508 from 4519167 to 4521068 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE protease IV
IP Peptidase S49, protease IV; Peptidase S49, SppA
CL
EC
GO Biological Process: proteolysis (GO:0006508)
Biological Process: signal peptide processing (GO:0006465)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: peptidase activity (GO:0008233)
PM
AN
SQ 633 aa
 
........10........20........30........40........50
| | | | |
MNHPVRRNPIASFFVGLWDVMNFTRRLIFNLVFFGFLFLLLLVFVVALAR
GDGTKPLAERTTLVINPEGTLVEQFSADPVSRSLAKAVGDKSAEEVQLRD
LVRVIEAAGKDRKIERVLLNLDKLQPSGFASQREVAVALQKLRASGKQIV
AFSESMSQGQYLLAAQANEVYLDPMGSVLLEGLGRYRQYFREGLQDKLGV
DVHLFRVGEYKSAAEPYILDAASADAKEADLFWMNDVWHRYLADVGTARK
LSPAQLAAGIDTLPEGVAAAGGDLAKFALQQKLVDGLKTREEVDALLVKR
GVADSDADSGFRNIGFNDYLSQLQAQRSPMDSRPQVAVVVAAGEISGGEQ
PAGRIGGESTAALLRQARDDEEVKAVVLRVDSPGGEVFASEQIRREVVAL
KQAGKPVVVSMGDLAASGGYWISMNADRIYADPSTISGSIGIFGMVPNLT
RALDKIGVHTDGVATTRFAGAFDITRPLDPAAGQVIQAVINKGYADFTGK
VAQARHQSVEAIDKVARGRVWSGAQAKERGLVDAFGGMSEAVADAADRAK
LSRGKFRVRYVEKPATPFSQFMSGFAGSRMGAWMLSDSGMARALLARSLP
EVDTQLRFVESAVHDSKAGGTPVKSLAYCFCGF
pubmed

10

631

S=1011 I=41 E=1.48499e-113

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 3522590

 

prodomImg

pubmed

51

545

S=823 I=38 E=9.75444e-91

Protease 4 EC=3.4.21.- ; Cell inner membrane Hydrolase Transmembrane

Pubmed 10675023

 

prodomImg

pubmed

364

536

S=324 I=36 E=2.5508e-30

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 9387221

 

prodomImg

pubmed

364

583

S=292 I=34 E=1.8901e-26

Putative signal peptide peptidase sppA EC=3.4.21.- ; Cell membrane Hydrolase Protease Transmembrane

Pubmed 10103244

 

prodomImg

pubmed

405

583

S=257 I=33 E=3.34921e-22

Putative peptidase pfaP EC=3.4.21.- ; Hydrolase Protease Signal

Pubmed 7628708

 

prodomImg

pubmed

335

538

S=249 I=32 E=3.68325e-21

Putative protease

Pubmed 11425734

 

prodomImg

pubmed

334

551

S=244 I=29 E=1.46049e-20

Peptidase ; Plasmid

Pubmed 18070959

 

prodomImg

pubmed

358

553

S=225 I=30 E=2.85322e-18

PspA

Pubmed 8793884

 

prodomImg

pubmed

334

441

S=218 I=45 E=2.06477e-17

Probe 6 protein

Pubmed 11805055

 

prodomImg

pubmed

334

536

S=205 I=29 E=6.81177e-16

Probable peptidase ; Plasmid

Pubmed 12547188,15466034

 

prodomImg

sp

10

631

S=1011 I=41 E=9.41415e-114

Protease 4 - Escherichia coli (strain K12)

Pubmed 3522590,7973728,

 

prodomImg

sp

51

545

S=823 I=38 E=6.18387e-91

Protease 4 - Haemophilus influenzae

Pubmed 10675023,

 

prodomImg

sp

81

564

S=699 I=37 E=6.89972e-76

Protease 4 homolog - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

364

536

S=324 I=36 E=1.61709e-30

Putative signal peptide peptidase sppA - Bacillus subtilis

Pubmed 9387221,10455123,

 

prodomImg

sp

352

574

S=308 I=35 E=1.67169e-28

Putative protease slr0021 - Synechocystis sp. (strain PCC 6803)

 

prodomImg

trembl

1

633

S=3130 I=95 E=0

Protease IV - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

633

S=3089 I=94 E=0

Protease IV - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

633

S=3086 I=94 E=0

Protease IV - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [PD002897]

161

217

-

Iprscan [PD002897]

405

487

-

Iprscan IPR004634 [PIRSF001217]

1

633

Peptidase S49, protease IV

Iprscan IPR002142 [PF01343]

141

256

Peptidase S49

Iprscan IPR002142 [PF01343]

399

552

Peptidase S49

Iprscan IPR004634 [TIGR00705]

18

609

Peptidase S49, protease IV

Iprscan IPR004635 [TIGR00706]

335

550

Peptidase S49, SppA

Iprscan [SignalP-NN(euk)]

1

51

-

Iprscan [tmhmm]

27

49

-

Iprscan [SSF52096]

321

540

-

Iprscan [SSF52096]

71

292

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gXAGOXFB)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits