Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3912rpoDYP_365643.1RNA polymerase sigma factor RpoD

rpoD XCV3912
XCV3911
XCV3911
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3913
XCV3913
ID rpoD
AC YP_365643.1
LT XCV3912
SY
OR NC_007508 from 4490897 to 4492774 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE RNA polymerase sigma factor RpoD
IP RNA polymerase sigma factor 70, region 1.1; RNA polymerase sigma factor 70, non-essential region; RNA polymerase sigma factor RpoD, C-terminal; RNA polymerase sigma factor RpoS, proteobacteria; RNA polymerase sigma-70
CL
EC
GO Biological Process: transcription initiation (GO:0006352)
Biological Process: regulation of transcription (GO:0045449)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: transcription regulator activity (GO:0030528)
Molecular Function: sigma factor activity (GO:0016987)
PM
AN
SQ 625 aa
 
........10........20........30........40........50
| | | | |
MANERPAQQSDIKLLISKGLEQGYLTYAEVNDHLPDDLVDPEQIEDIISM
INGMGIDVHEVAPDAETLLLNDGNTGNREVDDTAAEEAAAALTALDTEGG
RTTDPVRMYMREMGTVELLTREGEIAIAKRIEEGLSQVQAALGVFPLSTE
MLLADYEAHKEGKKRLAEIVVGFNDLIEEADAAAAALAAAGPVAVSDDEA
VDEDDDEDGDDEAAEEEAGPTGPDPVEVATRMENLANEYAKFKKAYAKNG
AEHKLVVKAREDMAAIFTTLKLPLPLTDALVTQLRGVVNGIKDHERKVLH
LATTVARMPRKDFIRSWEGNQTNLEWVEDALKRKQKWSSALRDVKDQIIS
EQQGSIEMEKANYLTLGEIKEISRAMAYGEAKARKAKKEMVEANLRLVIS
IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAI
TRSIADQARTIRIPVHMIETINKLNRISRQMLQQFGREATPEELAKEMDM
PEDKIRKVMKIAKEPISMETPIGDDEDSHLGDFIEDTNVESPIDNTTNIN
LSETVRDVLAGLTPREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQ
IEAKALRKLRHPSRSEQLRSFLDID
xansp

YP_365680.1 lcl|rpoH-XCV3949

386

610

S=240 I=30 E=3.62329e-22

RNA polymerase factor sigma-32

xansp

YP_363708.1 lcl|fliA-XCV1977

381

610

S=110 I=28 E=1.90841e-06

RNA polymerase sigma factor for flagellar operon FliA

pubmed

243

625

S=1936 I=96 E=0

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

1

147

S=657 I=86 E=1.38409e-70

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 9126341

 

prodomImg

pubmed

8

623

S=1821 I=60 E=0

RNA polymerase sigma factor ; DNA-binding DNA-directed Transcription regulation

Pubmed 9434175

 

prodomImg

pubmed

8

623

S=1769 I=59 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 7665535

 

prodomImg

pubmed

9

623

S=1750 I=58 E=0

RNA polymerase sigma-70 subunit ; DNA-binding factor Transcription regulation

Pubmed 15262936

 

prodomImg

pubmed

9

623

S=1737 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 1398077

 

prodomImg

pubmed

9

623

S=1731 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 3005129

 

prodomImg

pubmed

9

623

S=1711 I=57 E=0

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 7557408,6269063

 

prodomImg

pubmed

9

623

S=1711 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 6269063

 

prodomImg

pubmed

9

623

S=1710 I=57 E=0

RNA polymerase sigma factor rpoD ; DNA-binding Transcription regulation

Pubmed 11272828

 

prodomImg

sp

1

625

S=2975 I=92 E=0

RNA polymerase sigma factor rpoD - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

625

S=2898 I=90 E=0

RNA polymerase sigma factor rpoD - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

625

S=2629 I=80 E=0

RNA polymerase sigma factor rpoD - Xylella fastidiosa

 

prodomImg

sp

1

625

S=2614 I=80 E=0

RNA polymerase sigma factor rpoD - Xylella fastidiosa (strain Temecula1 / ATCC 700964)

 

prodomImg

sp

8

623

S=1769 I=59 E=0

RNA polymerase sigma factor rpoD - Pseudomonas fluorescens

Pubmed 7665535,

 

prodomImg

trembl

1

625

S=2956 I=91 E=0

RNA polymerase sigma-70 factor - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

625

S=2950 I=91 E=0

RNA polymerase sigma-70 factor - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

625

S=2950 I=91 E=0

RNA polymerase sigma-70 factor - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR000943 [PR00046]

414

427

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

438

446

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

562

574

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

583

598

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PR00046]

598

609

RNA polymerase sigma-70 factor

Iprscan IPR011991 [G3DSA:1.10.10.10]

463

514

Winged helix repressor DNA-binding

Iprscan IPR011991 [G3DSA:1.10.10.10]

544

622

Winged helix repressor DNA-binding

Iprscan [G3DSA:1.10.601.10]

118

459

-

Iprscan IPR009042 [PF00140]

103

139

RNA polymerase sigma-70 region 1.2

Iprscan IPR007127 [PF03979]

4

89

RNA polymerase sigma factor 70, region 1.1

Iprscan IPR007624 [PF04539]

464

546

RNA polymerase sigma-70 region 3

Iprscan IPR007627 [PF04542]

390

460

RNA polymerase sigma-70 region 2

Iprscan IPR007630 [PF04545]

558

611

RNA polymerase sigma-70 region 4

Iprscan IPR007631 [PF04546]

145

359

RNA polymerase sigma factor 70, non-essential region

Iprscan IPR012760 [TIGR02393]

386

623

RNA polymerase sigma factor RpoD, C-terminal

Iprscan IPR014284 [TIGR02937]

385

613

RNA polymerase sigma-70

Iprscan IPR000943 [PS00715]

414

427

RNA polymerase sigma-70 factor

Iprscan IPR000943 [PS00716]

583

609

RNA polymerase sigma-70 factor

Iprscan IPR013324 [SSF88659]

463

537

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013324 [SSF88659]

520

624

RNA polymerase sigma factor, regions 3 and 4

Iprscan IPR013325 [SSF88946]

121

457

RNA polymerase sigma factor, region 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XeT4PlXK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

160 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits