Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3703xanAYP_365434.1phosphoglucomutase / phosphomannomutase

xanA XCV3703
XCV3702
XCV3702
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3704
XCV3704
ID xanA
AC YP_365434.1
LT XCV3703
SY
OR NC_007508 from 4277704 to 4279050 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE phosphoglucomutase / phosphomannomutase
IP Phosphoglucosamine mutase; Phosphoacetylglucosamine mutase
CL
EC
GO Biological Process: carbohydrate metabolic process (GO:0005975)
phosphotransferases (GO:0016868)
PM
AN
SQ 448 aa
 
........10........20........30........40........50
| | | | |
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLAS
PALQEALSAGLRASGREVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNP
MDYNGMKLVREQARPISSDTGLFAIRDTVAADTAAPGEPTASEQSRTDKT
AYLEHLLSYVDRSTLKPLKLVVNAGNGGAGLIVDLLAPHLPFEFVRVFHE
PDGNFPNGIPNPLLPENRDATAKAVRDNGADFGIAWDGDFDRCFFFDHTG
RFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQS
GRSLADLVEARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTD
GISADFGQWRFNLRSSNTEPLLRLNVETRGDAALLETRTQEISALLRG
xansp

YP_365756.1 lcl|manB-XCV4025

6

439

S=556 I=37 E=1.21513e-60

phosphomannomutase

xansp

YP_364594.1 lcl|mrsA-XCV2863

6

447

S=297 I=30 E=3.03614e-29

phosphoglucosamine mutase

pubmed

1

448

S=2242 I=96 E=0

Phosphohexose mutases EC=5.4.2.2 EC=5.4.2.8 ; Exopolysaccharide synthesis Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosph

Pubmed 1370280,18304669

 

prodomImg

pubmed

1

447

S=1917 I=80 E=0

Phosphoglucomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 12761084

 

prodomImg

pubmed

1

448

S=1764 I=75 E=0

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 16585771

 

prodomImg

pubmed

2

446

S=1409 I=60 E=5.60593e-162

Phosphomannomutase EC=5.4.2.8 ; Isomerase Lipopolysaccharide biosynthesis Magnesium Metal-binding Phosphoprotein

Pubmed 1383393

 

prodomImg

pubmed

3

446

S=1404 I=60 E=2.57802e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

3

446

S=1404 I=60 E=2.69289e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

3

446

S=1403 I=60 E=3.26228e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

3

446

S=1402 I=60 E=4.20078e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

pubmed

3

447

S=1402 I=59 E=4.34987e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967,15375135

 

prodomImg

pubmed

3

446

S=1402 I=60 E=4.78771e-161

Phosphomannomutase ; Magnesium Metal-binding Phosphoprotein

Pubmed 11238967

 

prodomImg

sp

1

448

S=2250 I=96 E=0

Phosphohexose mutases [Includes: Phosphoglucomutase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

448

S=2242 I=96 E=0

Phosphohexose mutases [Includes: Phosphoglucomutase - Xanthomonas campestris pv. campestris (strain B100)

Pubmed 1370280,18304669,

 

prodomImg

sp

2

446

S=1409 I=60 E=3.52883e-162

Phosphomannomutase - Salmonella montevideo

Pubmed 1383393,

 

prodomImg

sp

3

446

S=1395 I=60 E=1.88051e-160

Phosphomannomutase - Salmonella typhimurium

Pubmed 1712067,

 

prodomImg

sp

3

446

S=1367 I=58 E=4.40825e-157

Phosphomannomutase - Escherichia coli (strain K12)

Pubmed 7815923,8759852,

 

prodomImg

trembl

1

448

S=2367 I=99 E=0

Phosphoglucomutase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

448

S=2358 I=99 E=0

Phosphoglucomutase; phosphomannomutase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

448

S=2358 I=99 E=0

Phosphoglucomutase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR005841 [PR00509]

167

186

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

201

214

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

230

245

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR005841 [PR00509]

90

104

Alpha-D-phosphohexomutase, N-terminal

Iprscan IPR016055 [G3DSA:3.40.120.10]

169

246

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

247

359

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [G3DSA:3.40.120.10]

5

119

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [PTHR22573]

244

439

-

Iprscan [PTHR22573:SF6]

244

439

-

Iprscan IPR005843 [PF00408]

370

448

Alpha-D-phosphohexomutase, C-terminal

Iprscan IPR005844 [PF02878]

3

136

Alpha-D-phosphohexomutase, alpha/beta/alpha domain I

Iprscan IPR005845 [PF02879]

150

252

Alpha-D-phosphohexomutase, alpha/beta/alpha domain II

Iprscan IPR005846 [PF02880]

254

365

Alpha-D-phosphohexomutase, alpha/beta/alpha domain III

Iprscan IPR016066 [PS00710]

91

100

Alpha-D-phosphohexomutase, conserved site

Iprscan IPR016055 [SSF53738]

1

174

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

149

253

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan IPR016055 [SSF53738]

254

361

Alpha-D-phosphohexomutase, alpha/beta/alpha I, II and III

Iprscan [SSF55957]

363

448

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vI67Hvkl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

186 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits