Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3659xpsNYP_365390.1general secretion pathway protein N

xpsN XCV3659
XCV3658
XCV3658
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3660
XCV3660
ID xpsN
AC YP_365390.1
LT XCV3659
SY
OR NC_007508 from 4215591 to 4216388 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE general secretion pathway protein N
IP
CL
EC
GO
PM
AN
SQ 265 aa
 
........10........20........30........40........50
| | | | |
MRLDMIGLRTWLLATVVGWALLVCVLAVAGLGKRVELLPDDPALVQRLPT
LPAPAPERLGPFEKYSEIAAHPAFAEDRLPHPFFLSGNDGSSAASTVRLT
GVLLTDNFKMATLTLDPQDSVRVQLGGEAVKGWRLLALQPRSATIEGPSG
TQTLELHVFNGQGGQPPTANAAARGAATATPPVPSPDAAALAPPQPPQPQ
PVAPVQQQQPGGQTPPTVPPQRSDGAQEAPRPSDDQMRAIRERIEARRRQ
LQQQRQSGSTPGQTQ
pubmed

1

165

S=689 I=83 E=5.98533e-75

General secretion pathway protein N ; Cell inner membrane Transmembrane Transport

Pubmed 10692359

 

prodomImg

sp

1

165

S=689 I=83 E=3.81428e-75

General secretion pathway protein N - Xanthomonas campestris pv. campestris

Pubmed 10692359,1313415,

 

prodomImg

trembl

1

165

S=729 I=87 E=6.38973e-79

General secretion pathway protein N - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

165

S=719 I=87 E=9.53453e-78

General secretion pathway protein N - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

165

S=719 I=87 E=9.53453e-78

General secretion pathway protein N - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Mown8MSy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

16 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits