Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3626grxYP_365357.1glutaredoxin-like protein

grx XCV3626
XCV3625
XCV3625
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3627
XCV3627
ID grx
AC YP_365357.1
LT XCV3626
SY
OR NC_007508 from 4171963 to 4172889 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE glutaredoxin-like protein
IP FeS cluster biogenesis; Rhodanese-like; Glutaredoxin-related protein; Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 308 aa
 
........10........20........30........40........50
| | | | |
MSLDPALRSRIDTLLQSSRVVLFMKGQPGMPQCGFSAKAVGVLDGLGIDY
AHVNVLADQEIREGIKAYGDWPTIPQLYVDGELIGGSDIIVQMADSGELS
SMLGLQAPDRSPPKITITPAAVEMLKSALADAPDASLTLAIDANFQPNFQ
LAPTNPNAIAAESNGLRVQFDLASARRADGITIDWVDDIRGRGLAIDNPN
APKPVQELSVRDADDRLKAGSLTLVDVRPADERALATVAAPFRTLDAHER
AAIEQLPKDTPLAFLCHRGGRSLQAAEHFRGLGFTNVYNVTGGIDAWSDE
VDNGVAKY
xansp

YP_364557.1 lcl|XCV2826

9

104

S=228 I=43 E=4.56026e-21

glutaredoxin-related protein

xansp

YP_363805.1 lcl|moeB-XCV2074

200

298

S=97 I=31 E=3.12e-05

molybdopterin biosynthesis protein MoeB

pubmed

3

103

S=302 I=50 E=5.08345e-28

Promoter active E3

Pubmed 10069856

 

prodomImg

pubmed

1

103

S=294 I=52 E=5.39886e-27

Monothiol glutaredoxin-5, mitochondrial ; Electron transport Mitochondrion Redox-active center Transit peptide

Pubmed 11950925

 

prodomImg

pubmed

9

103

S=286 I=52 E=5.07497e-26

Glutaredoxin-like protein

Pubmed 12065505

 

prodomImg

pubmed

6

103

S=283 I=48 E=1.17203e-25

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

2

103

S=282 I=47 E=1.21362e-25

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

3

138

S=268 I=38 E=7.8349e-24

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

3

99

S=277 I=47 E=4.93982e-25

Glutaredoxin

Pubmed 18156657

 

prodomImg

pubmed

7

103

S=276 I=45 E=6.52949e-25

Putative glutaredoxin-like protein

Pubmed 15365646

 

prodomImg

pubmed

1

104

S=271 I=46 E=3.02904e-24

Monothiol glutaredoxin-S16, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 12480930

 

prodomImg

pubmed

5

103

S=270 I=44 E=4.03886e-24

Glutaredoxin-3 ; Acetylation Cytoplasm Polymorphism Repeat

Pubmed 10636891,11124703

 

prodomImg

sp

3

103

S=316 I=52 E=5.90818e-30

Uncharacterized monothiol glutaredoxin ycf64-like - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

1

103

S=294 I=52 E=3.43243e-27

Monothiol glutaredoxin-5, mitochondrial precursor - Saccharomyces cerevisiae (Baker's yeast)

Pubmed 11950925,12730244,

 

prodomImg

sp

3

103

S=293 I=49 E=4.30577e-27

Monothiol glutaredoxin-5 - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

4

103

S=289 I=48 E=1.43413e-26

Monothiol glutaredoxin-S17 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 16720602,

 

prodomImg

sp

3

103

S=285 I=49 E=3.80783e-26

Monothiol glutaredoxin-S17 - Arabidopsis thaliana (Mouse-ear cress)

Pubmed 16720602,

 

prodomImg

trembl

1

308

S=1567 I=97 E=2.27952e-180

Glutaredoxin-like protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

308

S=1567 I=97 E=2.27952e-180

Glutaredoxin-like protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

308

S=1567 I=97 E=2.27952e-180

Putative glutaredoxin-like protein, putative - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR000361 [G3DSA:2.60.300.12]

106

199

FeS cluster biogenesis

Iprscan IPR001763 [G3DSA:3.40.250.10]

202

299

Rhodanese-like

Iprscan IPR012335 [G3DSA:3.40.30.10]

7

103

Thioredoxin fold

Iprscan IPR004480 [PTHR10293]

1

124

Glutaredoxin-related protein

Iprscan IPR002109 [PF00462]

20

84

Glutaredoxin

Iprscan IPR001763 [PF00581]

209

300

Rhodanese-like

Iprscan IPR000361 [PF01521]

115

199

FeS cluster biogenesis

Iprscan IPR001763 [SM00450]

208

303

Rhodanese-like

Iprscan IPR004480 [TIGR00365]

7

106

Glutaredoxin-related protein

Iprscan IPR001763 [PS50206]

218

306

Rhodanese-like

Iprscan IPR002109 [PS51354]

8

110

Glutaredoxin

Iprscan IPR001763 [SSF52821]

202

306

Rhodanese-like

Iprscan IPR012336 [SSF52833]

10

106

Thioredoxin-like fold

Iprscan IPR000361 [SSF89360]

113

203

FeS cluster biogenesis

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RI4BI6lD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

90 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits