Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3537YP_365268.1putative electron transfer protein azurin I

XCV3537
XCV3536
XCV3536
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3538
XCV3538
ID
AC YP_365268.1
LT XCV3537
SY
OR NC_007508 from 4052233 to 4052640 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative electron transfer protein azurin I
IP Cupredoxin; Azurin, proteobacteria
CL
EC
GO Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: copper ion binding (GO:0005507)
PM
AN
SQ 135 aa
 
........10........20........30........40........50
| | | | |
MAPTAWARTCAVTITGNDQMKFDQSAIKLAPECTQVELTLKHSGKMAATV
MGHNWVLTKSADFQAVANAGVRSTIADSYLPKADARVIAHTKVIGGGDST
TVSFPTSKLSKGADYTFFCSFPGHWAMMKGTLTFG
pubmed

7

134

S=420 I=59 E=6.77893e-43

Azurin ; Signal

Pubmed 11440141

 

prodomImg

pubmed

2

134

S=410 I=55 E=8.7982e-42

Azurin I ; Signal

Pubmed 16832626

 

prodomImg

pubmed

10

134

S=399 I=55 E=2.03019e-40

Azurin-1 ; Copper Electron transport Metal-binding Periplasm

Pubmed 9761902

 

prodomImg

pubmed

7

134

S=376 I=54 E=1.39196e-37

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2116366,6842609

 

prodomImg

pubmed

10

135

S=375 I=54 E=1.87227e-37

Azurin-2 ; Copper Electron transport Metal-binding Periplasm

Pubmed 7640272,15299774

 

prodomImg

pubmed

10

135

S=359 I=48 E=1.51624e-35

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 6274637,6960351

 

prodomImg

pubmed

10

134

S=358 I=51 E=1.85292e-35

Azurin ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 2537198,2116366

 

prodomImg

pubmed

10

133

S=348 I=50 E=3.49872e-34

Azurin ; Copper Electron transport Metal-binding Periplasm

Pubmed 15299879

 

prodomImg

pubmed

10

134

S=346 I=50 E=5.65155e-34

Azurin

Pubmed 12730177

 

prodomImg

pubmed

4

133

S=343 I=46 E=1.21725e-33

Azurin iso-1 ; Copper Electron transport Metal-binding Periplasm Signal

Pubmed 9648216,2505762

 

prodomImg

sp

10

134

S=407 I=56 E=1.43158e-41

Azurin - Alcaligenes sp.

 

prodomImg

sp

2

134

S=405 I=55 E=2.52312e-41

Azurin precursor - Bordetella pertussis

 

prodomImg

sp

2

134

S=405 I=55 E=2.52312e-41

Azurin precursor - Bordetella parapertussis

 

prodomImg

sp

2

134

S=405 I=55 E=2.52312e-41

Azurin precursor - Bordetella bronchiseptica (Alcaligenes bronchisepticus)

 

prodomImg

sp

10

134

S=399 I=55 E=1.31095e-40

Azurin-1 - Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans)

Pubmed 9761902,

 

prodomImg

trembl

1

135

S=709 I=99 E=4.00769e-77

Electron transfer protein azurin I - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

135

S=691 I=95 E=6.08025e-75

Electron transfer protein azurin I - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

135

S=691 I=95 E=6.08025e-75

Azurin - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD003655]

10

135

-

Iprscan IPR008972 [G3DSA:2.60.40.420]

8

135

Cupredoxin

Iprscan IPR000923 [PF00127]

8

135

Blue (type 1) copper domain

Iprscan IPR014068 [TIGR02695]

10

134

Azurin, proteobacteria

Iprscan IPR000923 [PS00196]

112

128

Blue (type 1) copper domain

Iprscan [SignalP-NN(euk)]

1

7

-

Iprscan IPR008972 [SSF49503]

8

135

Cupredoxin

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one g8oqJbv7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
trembl

TrEMBL ncbi-blastp

92 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits