Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3168YP_364899.1two-component system sensor histidine kinase-response regulator hybrid protein

XCV3168
XCV3167
XCV3167
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3169
XCV3169
ID
AC YP_364899.1
LT XCV3168
SY
OR NC_007508 from 3598177 to 3601752 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE two-component system sensor histidine kinase-response regulator hybrid protein
IP Signal transduction histidine kinase, homodimeric; CheY-like; Two component regulator three Y; Signal transduction histidine kinase, TMAO sensor TorS
CL
EC
GO Biological Process: signal transduction (GO:0007165)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: phosphorylation (GO:0016310)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: two-component response regulator activity (GO:0000156)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 1191 aa
 
........10........20........30........40........50
| | | | |
MRVLIVVLAVLLAIWPCAAKIPEVPRFRIVGPSEGLPSTMVVAISQDRAG
YLWLGTLDGLVRYDGAGFRTWRHDPADPGSLPCNAVQALHIDALDRVWVG
CGKTLSVLDAGRRRFVHYRAADYPLLKDGEIFSIAAFDGGIWAGTTTGAL
VRIGADGGMSSVNLGGIEGALDHAMVMNLAVDNQHRLWIGTSNGLAYYDG
TQLHRQYVADEPNREAAIFGLQWAGDRLWLGSESGLHVLRADGRWQPLAW
STMFGNGNEFWGAVATPDGEFWLGSGRGLWRTRGERPPVPALSGEGPLSR
RNVIGLMGAADGGLWVPMHGTGLGYLPADWKRSAVLKPAVPMGDAIYCNL
APAKRSGGLWQVDAQGRLLRVDPSTGDSFQTGLQSPQLKGMELVSALEDR
LQRVWLGNLTFGLSRMDLRTGDFVHWPSDGPEPSSALSAPEWIMEHGDTV
WMAFIDMVQQRDLRTGKVLQRMTQQGLHGLRAIDIQQLDQGPDGRVWVAG
EGGMFAWDDATSRFVPVAGLEGTPIQAFASQSADTLWVYRASGAEQWQKR
AAGWKRVRQVGEADGLSGFDASAMQIDPRGRVWISSLRGLWRIDPSVHPA
RVRNIGTRDGLTSQEFIQHCLLTSGDTLIGATSDGSTVLLDTAMPDVAPF
VPALQLEHVSVLRNGARIALPMDRPFQLGPEDRQLQIVSRLLSYSDPLSN
RYRSFLKGFDTDWQTIGNTGIREFASLPAGNYALALQGIDPLGNRSQVRS
LQFSVRPPWWRSEIGIAAIGFSGLLLSALLAAAYRRRIRMRAQWQLAQHK
RELAEQASLAKTRFLATLGHEVRTPMTGVLGMSELLLQTPLDGRQQGYAS
AIQLAGKHLLRLVNDALDLARIEAGKLPLDYRDFDLRQLVGQVVELVRPS
AEQKQLAFQCELDEALPPALHGDASRVQQILLNLLFNAVKFTERGSVHLR
LTTLPQYTRQGLRVEVRDTGPGMSAEQRGRLFQRFEQAEGALTLARHGGS
GLGLAICRELAAAMGGAVTVTSELGQGACFVVELPLHWVSTLPAVTLPAV
RAPSLREQAPLQLLLVEDDATVAQVIVGLLQTRGHHVTHVLHGLAALAEV
STRSFDAGLCDLDLPGLDGAALVAQLRARGVRFPIVAVTARADTDAEPQA
MAAGCNGFLRKPVTGDLLAQALARVLADVDDGQRDREAGDA
xansp

YP_364897.1 lcl|XCV3166

15

1176

S=1825 I=40 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_364896.1 lcl|XCV3165

15

1176

S=1755 I=39 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_364898.1 lcl|XCV3167

23

1170

S=1574 I=38 E=0

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_363650.1 lcl|rpfC-XCV1919

804

1175

S=484 I=35 E=1.69154e-51

sensory/regulatory protein RpfC

xansp

YP_362259.1 lcl|XCV0528

801

1039

S=456 I=42 E=3.8629e-48

two-component system sensor protein

xansp

YP_364402.1 lcl|XCV2671

804

1176

S=418 I=34 E=1.62269e-43

two-component system sensor histidine kinase-response regulator hybridprotein

xansp

YP_363063.1 lcl|XCV1332

793

1035

S=394 I=42 E=1.25701e-40

two-component system sensor/response regulator fusionprotein

xansp

YP_363946.1 lcl|XCV2215

801

1087

S=355 I=37 E=6.56635e-36

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_365535.1 lcl|XCV3804

801

1164

S=353 I=35 E=1.14726e-35

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_365524.1 lcl|XCV3793

810

1174

S=349 I=30 E=3.65819e-35

two-component system sensor histidine kinase-response regulator hybrid protein

pubmed

798

1191

S=524 I=36 E=3.5383e-54

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 14660379

 

prodomImg

pubmed

804

1174

S=504 I=36 E=9.13688e-52

Putative histidine kinase sensor/regulator

Pubmed 18487337

 

prodomImg

pubmed

799

1188

S=498 I=36 E=5.13483e-51

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

804

1173

S=484 I=34 E=2.552e-49

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

804

1173

S=482 I=34 E=3.7453e-49

Sensory/regulatory protein rpfC EC=2.7.13.3 ; Cell inner membrane Kinase Phosphoprotein Transcription regulation Transferase Transmembrane Two-

Pubmed 1645442

 

prodomImg

pubmed

801

1174

S=481 I=33 E=5.99733e-49

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 15186417

 

prodomImg

pubmed

801

1055

S=476 I=39 E=2.12325e-48

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15262936

 

prodomImg

pubmed

797

1172

S=472 I=33 E=5.9403e-48

Autoinducer 2 sensor kinase/phosphatase luxQ EC=2.7.13.3 EC=3.1.3.- ; Cell inner membrane Hydrolase Phosphoprotein Transferase Transmembrane T

Pubmed 12176318

 

prodomImg

pubmed

797

1172

S=471 I=33 E=8.64228e-48

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 16567412

 

prodomImg

pubmed

804

1175

S=467 I=35 E=3.00676e-47

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

sp

804

1173

S=484 I=34 E=1.59708e-49

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris

 

prodomImg

sp

804

1173

S=482 I=34 E=2.3644e-49

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 1645442,

 

prodomImg

sp

797

1172

S=472 I=33 E=3.7501e-48

Autoinducer 2 sensor kinase/phosphatase luxQ - Vibrio cholerae

Pubmed 12176318,9190823,

 

prodomImg

sp

793

1034

S=465 I=40 E=2.73757e-47

Hybrid signal transduction histidine kinase L - Dictyostelium discoideum (Slime mold)

Pubmed 11060029,

 

prodomImg

sp

800

1163

S=453 I=31 E=7.78725e-46

Autoinducer 2 sensor kinase/phosphatase luxQ - Vibrio vulnificus (strain YJ016)

 

prodomImg

trembl

15

1191

S=5655 I=93 E=0

Sensor protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

16

1191

S=5384 I=88 E=0

Sensor protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

16

1191

S=5383 I=88 E=0

Histidine kinase-response regulator hybrid protein - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD000039]

1064

1176

-

Iprscan IPR004358 [PR00344]

1022

1035

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

962

976

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

980

990

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

998

1016

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

877

1038

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

1061

1176

-

Iprscan [PTHR23283]

397

1181

-

Iprscan [PTHR23283]

397

403

-

Iprscan [PTHR23283]

800

1181

-

Iprscan [PTHR23283:SF49]

397

1181

-

Iprscan [PTHR23283:SF49]

397

403

-

Iprscan [PTHR23283:SF49]

800

1181

-

Iprscan IPR001789 [PF00072]

1061

1173

Signal transduction response regulator, receiver region

Iprscan IPR003661 [PF00512]

810

875

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR003594 [PF02518]

922

1037

ATP-binding region, ATPase-like

Iprscan IPR011110 [PF07494]

125

147

Two component regulator propeller

Iprscan IPR011110 [PF07494]

170

193

Two component regulator propeller

Iprscan IPR011110 [PF07494]

210

234

Two component regulator propeller

Iprscan IPR011110 [PF07494]

253

277

Two component regulator propeller

Iprscan IPR011110 [PF07494]

35

58

Two component regulator propeller

Iprscan IPR011110 [PF07494]

387

410

Two component regulator propeller

Iprscan IPR011110 [PF07494]

476

502

Two component regulator propeller

Iprscan IPR011110 [PF07494]

564

588

Two component regulator propeller

Iprscan IPR011110 [PF07494]

80

103

Two component regulator propeller

Iprscan IPR011123 [PF07495]

693

756

Two component regulator three Y

Iprscan IPR003594 [SM00387]

922

1038

ATP-binding region, ATPase-like

Iprscan IPR003661 [SM00388]

810

875

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR001789 [SM00448]

1061

1172

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

817

1038

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

1062

1176

Signal transduction response regulator, receiver region

Iprscan [SignalP-NN(euk)]

1

19

-

Iprscan IPR009082 [SSF47384]

800

871

Signal transduction histidine kinase, homodimeric

Iprscan IPR011006 [SSF52172]

1058

1177

CheY-like

Iprscan IPR003594 [SSF55874]

864

1048

ATP-binding region, ATPase-like

Iprscan [SSF63829]

374

596

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2wSnFnzX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

294 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

56 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

36 hits