Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3161aroBYP_364892.13-dehydroquinate synthase

aroB XCV3161
XCV3160
XCV3160
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3162
XCV3162
ID aroB
AC YP_364892.1
LT XCV3161
SY
OR NC_007508 from 3582082 to 3583194 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE 3-dehydroquinate synthase
IP 3-dehydroquinate synthase AroB; 3-dehydroquinate synthase
CL
EC
GO Biological Process: aromatic amino acid family biosynthetic process (GO:0009073)
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: 3-dehydroquinate synthase activity (GO:0003856)
acting on phosphates (GO:0016838)
PM
AN
SQ 370 aa
 
........10........20........30........40........50
| | | | |
MTLPRSSRSVDLDGVQPYTITIAPGLLADGARLAGHVRGRHALLLSDSQV
APHYAAGVRTALLNARPDLQVGELVIAAGEASKTLETFGSAITALAELGA
TRDACVFALGGGVVGDLAGFAAACWMRGVDCVQLPTSLLAMVDSSVGGKT
AVDIPQGKNLVGAFHPPRAVIADTDTLRTLPPRELRAGLAEVIKYGAIRD
PLFFQWLHAERRALLDGDAAALAQAIARSCEHKAEIVARDPLEKGERALL
NLGHTFGHAIETEQGYGAPGNDNLNHGEAVAVGMVLAARLSAALGMSDAQ
DTEALRTLLHDFDLPTEIPPGLTPQALLARMRLDKKNIAGRLRLVLWRGI
GKAEIVPDVEEAAVLEILAG
pubmed

14

369

S=618 I=43 E=3.0415e-66

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cobalt Cytoplasm Lyase NAD

Pubmed 9405209

 

prodomImg

pubmed

10

368

S=617 I=39 E=4.99941e-66

Dehydroquinate synthase EC=4.6.1.3 ; Lyase

Pubmed 8704160

 

prodomImg

pubmed

14

369

S=595 I=43 E=1.89465e-63

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cobalt Cytoplasm Lyase NAD

Pubmed 3009224,7603433

 

prodomImg

pubmed

10

358

S=580 I=42 E=1.46891e-61

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 7901733

 

prodomImg

pubmed

18

365

S=554 I=41 E=2.1692e-58

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 9613570

 

prodomImg

pubmed

4

365

S=550 I=38 E=6.45079e-58

3-dehydroquinate synthase EC=4.2.3.4 ; Lyase

Pubmed 18043661

 

prodomImg

pubmed

134

366

S=539 I=52 E=1.37618e-56

3-dehydroquinate synthase

Pubmed 12904568

 

prodomImg

pubmed

40

368

S=435 I=34 E=4.82355e-44

3-dehydroquinate synthase EC=4.6.1.3 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 9403840

 

prodomImg

pubmed

10

366

S=431 I=29 E=1.51147e-43

3-dehydroquinate synthase ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 15716086

 

prodomImg

pubmed

16

356

S=426 I=33 E=5.68785e-43

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 11722738

 

prodomImg

sp

1

370

S=1617 I=86 E=0

3-dehydroquinate synthase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

370

S=1592 I=85 E=0

3-dehydroquinate synthase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

369

S=1528 I=82 E=1.04536e-176

3-dehydroquinate synthase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

369

S=1528 I=82 E=1.04536e-176

3-dehydroquinate synthase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

369

S=1240 I=67 E=8.6026e-142

3-dehydroquinate synthase - Xylella fastidiosa (strain Temecula1 / ATCC 700964)

 

prodomImg

trembl

1

370

S=1595 I=85 E=0

3-dehydroquinate synthase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

370

S=1592 I=85 E=0

3-dehydroquinate synthase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

370

S=1527 I=82 E=1.8233e-175

3-dehydroquinate synthase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

Iprscan [G3DSA:1.20.1090.10]

180

357

-

Iprscan [G3DSA:3.40.50.1970]

4

179

-

Iprscan IPR016303 [PIRSF001455]

1

369

3-dehydroquinate synthase

Iprscan [PTHR21090]

18

370

-

Iprscan IPR002658 [PTHR21090:SF1]

18

370

3-dehydroquinate synthase AroB

Iprscan IPR002658 [PF01761]

22

338

3-dehydroquinate synthase AroB

Iprscan IPR016037 [TIGR01357]

18

368

3-dehydroquinate synthase AroB, subgroup

Iprscan [SSF56796]

7

370

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NpEYKwgw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

85 hits
swiss-prot

Swiss-Prot ncbi-blastp

225 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits