Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3125ptsIYP_364856.1enzyme I of the phosphotransferase system

ptsI XCV3125
XCV3124
XCV3124
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3126
XCV3126
ID ptsI
AC YP_364856.1
LT XCV3125
SY
OR NC_007508 from 3540643 to 3542373 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE enzyme I of the phosphotransferase system
IP Phosphotransferase system, PEP-utilising enzyme, N-terminal; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: phosphorylation (GO:0016310)
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 576 aa
 
........10........20........30........40........50
| | | | |
MSLRLRGHGAARGNALGRARVRQSHTLEVAEQRVPANQVETQLQRLHAAI
ASARVEMQQLRDRLHGALAREVGEFLELHALLLDDPELLQGLDELIRTHR
YSADYALRVQRDRLAAVFDGMEDAYLKSRMDDLDHVIGRIHAFLHKRAPD
LKGVAGEILVCDNVAPSELAQLQAQGVVGIVTTAGSTLSHSAILARSLHL
PLVVGVSDALQRIEDGDVLIVDAGSGQVIVDPKPEHLRDYRERLRALAKE
QRELGRLRSKPTRTRDNVDITLLANAESLEDVANAHALGASGLGLYRTEF
LFLQRNELPDEDEQFHTYRDTVLGMSGHPVTIRTLDLGADKADRTGLTLS
DEDNPALGLRGVRLSLARPAVAQAQLRAILRASGYGPVRILVPMVSGREE
ILQLRKQLKKLTAQLRAEGHEIAEHIPLGAMIEVPAAALALDCFIDDIDF
LSIGTNDLVQYLLAVDRNNEALGELYSPLHPAVLRLIAQVIATGRTYGKP
VAVCGEIAGDPRFVPMLLALGLTEFSLHPATLLEVRRAVRDTHLGELRVH
GEKLLRARDRKGIEKWLAGHAQGLLR
xansp

YP_364410.1 lcl|fruB-XCV2679

158

555

S=612 I=40 E=2.82925e-67

multiphosphoryl transfer protein FruB

xansp

YP_363933.1 lcl|ppsA-XCV2202

155

535

S=243 I=28 E=1.2874e-22

phosphoenolpyruvate synthase

pubmed

32

567

S=944 I=38 E=1.86354e-105

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

96

559

S=926 I=46 E=2.9791e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1653223

 

prodomImg

pubmed

30

536

S=924 I=40 E=4.68796e-103

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

27

539

S=905 I=42 E=1.02576e-100

Putative phosphoenolpyruvate-protein phosphotransferase ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 18328084

 

prodomImg

pubmed

102

540

S=889 I=42 E=8.23485e-99

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

pubmed

28

540

S=886 I=36 E=1.80485e-98

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 9726852

 

prodomImg

pubmed

39

547

S=885 I=36 E=2.49196e-98

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

40

555

S=879 I=36 E=1.28353e-97

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

45

555

S=878 I=36 E=2.0553e-97

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12610726

 

prodomImg

pubmed

32

555

S=869 I=36 E=2.12647e-96

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

sp

32

555

S=970 I=37 E=8.15985e-109

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

96

559

S=926 I=46 E=1.87661e-103

Phosphoenolpyruvate-protein phosphotransferase - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Pubmed 1653223,

 

prodomImg

sp

30

536

S=924 I=40 E=2.95306e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 7670643,

 

prodomImg

sp

30

536

S=922 I=39 E=5.25026e-103

Phosphoenolpyruvate-protein phosphotransferase - Bacillus sp. (strain S)

 

prodomImg

sp

28

555

S=894 I=36 E=1.51721e-99

Phosphoenolpyruvate-protein phosphotransferase - Bacillus megaterium

 

prodomImg

trembl

23

576

S=2697 I=96 E=0

Phosphotransferase system enzyme I - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

23

575

S=2587 I=92 E=0

Phosphotransferase system enzyme I - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

23

575

S=2580 I=92 E=0

Phosphotransferase system enzyme I - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD000940]

342

529

-

Iprscan IPR006318 [PR01736]

294

313

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

449

464

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

466

481

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

502

514

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

24

144

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

251

575

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan [PTHR22931]

3

556

-

Iprscan [PTHR22931:SF10]

3

556

-

Iprscan IPR008279 [PF00391]

147

226

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

251

544

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

5

130

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR006318 [TIGR01417]

5

568

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR000121 [PS00742]

449

467

PEP-utilizing enzyme

Iprscan IPR008731 [SSF47831]

25

147

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

246

547

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

128

250

PEP-utilising enzyme, mobile region

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CtdhDvOA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

87 hits
swiss-prot

Swiss-Prot ncbi-blastp

86 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits