Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV3047YP_364778.1putative alcohol dehydrogenase

XCV3047
XCV3046
XCV3046
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV3048
XCV3048
ID
AC YP_364778.1
LT XCV3047
SY
OR NC_007508 from 3470255 to 3471262 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MHAIRLRHPAAIASLQSVALPDPGQPARGQIRVRLHASSLNFHDLGVVLG
QMPTADGRIPMSDGAGVVEAVGPEVDEFAVGDHVVSTFFPQWLDGEPLHA
GFATTPGDGVDGYARSAVVADAQAFTHAPRGYSHAEAATLTTAGVTAWRA
LAVNGGLKAGDSVLVLGTGGVSIFALQFAKAMGARVIATSSSDEKLEKVR
ALGADHLINYRQHPEWAAQVLDITEGRGVDHVVEVGGPGTLTQSIRAARV
DGHIALIGVLTGAAGPVPTAEMMGRQQRLQGLVVGSRRHQQNLVRALDSL
PLRPVIDRSFALDEIGEAFALQKAGGHLGKIALEF
xansp

YP_361916.1 lcl|XCV0185

20

335

S=423 I=38 E=1.0509e-44

putative alcohol dehydrogenase

xansp

YP_362575.1 lcl|XCV0844

14

335

S=197 I=29 E=2.52219e-17

putative quinone oxidoreductase

xansp

YP_362772.1 lcl|XCV1041

14

212

S=134 I=31 E=1.0661e-09

putative oxidoreductase

xansp

YP_363901.1 lcl|XCV2170

1

295

S=133 I=24 E=1.59213e-09

putative oxidoreductase

xansp

YP_364064.1 lcl|XCV2333

112

325

S=128 I=26 E=5.25689e-09

putative Zn-dependent alcohol dehydrogenase

xansp

YP_362519.1 lcl|XCV0788

136

325

S=121 I=27 E=4.68966e-08

putative alcohol dehydrogenase class III

xansp

YP_363810.1 lcl|XCV2079

120

237

S=111 I=33 E=6.3578e-07

Zinc-containing alcohol dehydrogenase superfamily protein

xansp

YP_362783.1 lcl|tdh-XCV1052

160

335

S=110 I=24 E=8.55161e-07

L-threonine 3-dehydrogenase

xansp

YP_362444.1 lcl|XCV0713

136

324

S=109 I=30 E=1.02699e-06

putative alcohol dehydrogenase class III

xansp

YP_361765.1 lcl|XCV0034

107

319

S=108 I=26 E=1.56069e-06

Zinc-containing alcohol dehydrogenase superfamily protein

pubmed

21

334

S=476 I=36 E=4.73109e-49

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

160

335

S=363 I=49 E=2.32789e-35

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

113

335

S=267 I=33 E=9.06682e-24

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

95

335

S=230 I=35 E=3.5521e-19

Putative NADPH:quinone oxidoreductase (Putative alcohol dehydrogenase) EC=1.1.1.1

Pubmed 9177244,9573182

 

prodomImg

pubmed

111

333

S=225 I=33 E=1.17283e-18

Putative NADPH:quinone oxidoreductase GrhO7

Pubmed 12323376

 

prodomImg

pubmed

118

334

S=221 I=36 E=4.29958e-18

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

113

333

S=219 I=34 E=6.20096e-18

Zn-dependent alcohol dehydrogenase class III EC=1.1.1.1 ; Oxidoreductase

Pubmed 15028704

 

prodomImg

pubmed

129

335

S=214 I=30 E=3.05766e-17

Putative quinone oxidoreductase EC=1.-.-.- ; Acetylation Alternative splicing Polymorphism

Pubmed 9305847,15067011

 

prodomImg

pubmed

107

335

S=213 I=30 E=3.80235e-17

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8049268

 

prodomImg

pubmed

131

333

S=211 I=33 E=6.08868e-17

Alcohol dehydrogenase

Pubmed 10940013

 

prodomImg

sp

23

334

S=548 I=39 E=5.52669e-58

Zinc-type alcohol dehydrogenase-like protein C1773.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

129

335

S=214 I=30 E=1.92564e-17

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

107

335

S=213 I=30 E=2.39462e-17

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

111

334

S=207 I=31 E=1.26608e-16

Alcohol dehydrogenase 2 - Candida albicans (Yeast)

 

prodomImg

sp

111

334

S=206 I=28 E=1.7944e-16

Alcohol dehydrogenase 3, mitochondrial precursor - Kluyveromyces lactis (Yeast) (Candida sphaerica)

Pubmed 1872030,

 

prodomImg

trembl

1

335

S=1572 I=92 E=0

Alcohol dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

335

S=1453 I=85 E=1.6383e-166

Alcohol dehydrogenase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

335

S=1453 I=85 E=1.6383e-166

Alcohol dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

122

310

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

14

335

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

106

335

-

Iprscan [PTHR11695:SF21]

14

335

-

Iprscan [PTHR11695:SF21]

14

88

-

Iprscan IPR013149 [PF00107]

159

299

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

28

85

Alcohol dehydrogenase GroES-like

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan IPR011032 [SSF50129]

1

163

GroES-like

Iprscan IPR016040 [SSF51735]

133

302

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TfJK1nwv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

239 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

10 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits