Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2943YP_364674.1hypothetical protein

XCV2943
XCV2942
XCV2942
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2944
XCV2944
ID
AC YP_364674.1
LT XCV2943
SY
OR NC_007508 from 3347432 to 3347878 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE hypothetical protein
IP
CL
EC
GO
PM
AN
SQ 148 aa
 
........10........20........30........40........50
| | | | |
MTSDQINVDSMVASFFSGLGIRLGLTDALVQRLREGETVLGPAGMLCRVH
AQPRNDGVSGFPEVILPLAARELEGDEVVTLLALQEQLLTEYGWRLTMSN
LGLLCICPLLLAQTPEDVAATLERGQIVARVVLDALVTQAGSAREAVV
xansp

YP_362144.1 lcl|XCV0413

60

145

S=215 I=52 E=5.67299e-20

hypothetical protein

xansp

YP_362143.1 lcl|XCV0412

1

52

S=144 I=58 E=2.1022e-11

hypothetical protein

pubmed

1

145

S=341 I=50 E=2.65731e-33

Hpa3

Pubmed 15986924

 

prodomImg

pubmed

1

145

S=339 I=50 E=5.3378e-33

Hpa3

Pubmed 16957248

 

prodomImg

trembl

1

148

S=607 I=83 E=1.21868e-64

Putative uncharacterized protein - Xanthomonas euvesicatoria

 

prodomImg

trembl

1

145

S=341 I=50 E=1.72625e-32

Putative uncharacterized protein XOO0104 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

145

S=341 I=50 E=1.72625e-32

Hpa3 - Xanthomonas oryzae pv. oryzae

Pubmed 15986924,

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OIZSEiIR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

11 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits