Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2826YP_364557.1glutaredoxin-related protein

XCV2826
XCV2825
XCV2825
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2827
XCV2827
ID
AC YP_364557.1
LT XCV2826
SY
OR NC_007508 from 3216665 to 3216985 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE glutaredoxin-related protein
IP Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 106 aa
 
........10........20........30........40........50
| | | | |
MPVMERIQAEVEQHPIVLFMKGTPQFPMCEFSSRAVQALVAAGADQLRTV
NVLEEPEVRANLPRYSNWPTFPQLFIHGELIGGCDITLELFEAGELKRIV
SEAYQP
xansp

YP_365357.1 lcl|grx-XCV3626

5

101

S=228 I=43 E=8.91748e-22

glutaredoxin-like protein

pubmed

1

103

S=295 I=47 E=4.33198e-28

Glutaredoxin-4 ; Cytoplasm Electron transport Redox-active center

Pubmed 9511768

 

prodomImg

pubmed

3

103

S=279 I=48 E=3.60118e-26

Glutaredoxin-like protein

Pubmed 12065505

 

prodomImg

pubmed

5

102

S=275 I=53 E=1.14829e-25

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

106

S=256 I=44 E=2.46909e-23

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

5

102

S=221 I=42 E=4.49112e-19

Monothiol glutaredoxin-S11 ; Cytoplasm Electron transport Redox-active center Repeat

Pubmed 12791992

 

prodomImg

pubmed

6

96

S=252 I=53 E=7.4069e-23

Putative uncharacterized protein

Pubmed 12904565

 

prodomImg

pubmed

5

103

S=252 I=51 E=7.53719e-23

Monothiol glutaredoxin-S14, chloroplastic ; Electron transport Plastid Redox-active center Transit peptide

Pubmed 12480930

 

prodomImg

pubmed

4

103

S=250 I=43 E=1.30545e-22

Probable monothiol glutaredoxin-2 ; Electron transport Redox-active center

Pubmed 9274032

 

prodomImg

pubmed

3

103

S=248 I=45 E=1.96664e-22

Putative glutaredoxin-like protein

Pubmed 15365646

 

prodomImg

pubmed

11

96

S=248 I=48 E=2.12718e-22

Glutaredoxin 5 homolog (S. cerevisiae) (Novel protein)

Pubmed 16110529

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Shigella flexneri

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli (strain K12)

Pubmed 7559321,15833738,15840565,

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli O6

 

prodomImg

sp

3

102

S=317 I=50 E=5.81889e-31

Glutaredoxin-4 - Escherichia coli O157:H7

 

prodomImg

sp

1

103

S=314 I=54 E=1.545e-30

Glutaredoxin-4 - Buchnera aphidicola subsp. Schizaphis graminum

 

prodomImg

trembl

1

106

S=558 I=100 E=5.51045e-59

Putative uncharacterized protein XAC2676 - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

106

S=548 I=97 E=8.22249e-58

Putative uncharacterized protein XCC2500 - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

106

S=548 I=97 E=8.22249e-58

Putative uncharacterized protein - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

3

100

Thioredoxin fold

Iprscan IPR002109 [PS51354]

4

106

Glutaredoxin

Iprscan IPR012336 [SSF52833]

6

103

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one w2YNdSVW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
trembl

TrEMBL ncbi-blastp

758 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits