Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2709coaDYP_364440.1phosphopantetheine adenylyltransferase

coaD XCV2709
XCV2708
XCV2708
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2710
XCV2710
ID coaD
AC YP_364440.1
LT XCV2709
SY
OR NC_007508 from 3068456 to 3068962 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE phosphopantetheine adenylyltransferase
IP Coenzyme A biosynthesis protein; Rossmann-like alpha/beta/alpha sandwich fold
CL
EC
GO Biological Process: biosynthetic process (GO:0009058)
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Molecular Function: pantetheine-phosphate adenylyltransferase activity (GO:0004595)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: nucleotidyltransferase activity (GO:0016779)
PM
AN
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL
SLERRVALAQEALAAHTNVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDF
EYEFQMASMNRHLIPEVETLFLTPAEQYSFISSSLVREIARLGGDVSGFV
PASVVEALRQVRQSRAQA
Hamap COAD_MF_00151 raw_score=4110 norm_score=35.533

Phosphopantetheine adenylyltransferase [coaD].

pubmed

1

164

S=738 I=88 E=3.13823e-81

Putative uncharacterized protein kdtB ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 16102911

 

prodomImg

pubmed

6

158

S=515 I=61 E=2.98904e-54

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 11371519

 

prodomImg

pubmed

7

158

S=507 I=61 E=3.0657e-53

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 2033061,8041620

 

prodomImg

pubmed

7

159

S=504 I=64 E=5.89545e-53

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 8765743

 

prodomImg

pubmed

6

158

S=497 I=58 E=4.90499e-52

Phosphopantetheine adenyltransferase ; Coenzyme biosynthesis Cytoplasm

Pubmed 12427940

 

prodomImg

pubmed

6

158

S=479 I=61 E=7.77315e-50

CoaD

Pubmed 18310345

 

prodomImg

pubmed

7

160

S=462 I=51 E=8.54129e-48

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 17493812

 

prodomImg

pubmed

9

160

S=444 I=53 E=1.33018e-45

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 12427940

 

prodomImg

pubmed

7

163

S=442 I=52 E=2.22492e-45

Predicted phosphopantetheine adenylyltransferase ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 10988064

 

prodomImg

pubmed

10

159

S=423 I=55 E=4.74258e-43

Transferase ; Coenzyme biosynthesis Cytoplasm Nucleotidyltransferase

Pubmed 14684898

 

prodomImg

sp

1

168

S=856 I=99 E=8.6756e-96

Phosphopantetheine adenylyltransferase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

168

S=846 I=98 E=1.46261e-94

Phosphopantetheine adenylyltransferase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

168

S=846 I=98 E=1.46261e-94

Phosphopantetheine adenylyltransferase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

167

S=830 I=96 E=1.39788e-92

Phosphopantetheine adenylyltransferase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

167

S=830 I=96 E=1.39788e-92

Phosphopantetheine adenylyltransferase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

168

S=846 I=98 E=1.5372e-93

Pantetheine-phosphate adenylyltransferase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

167

S=824 I=96 E=8.11388e-91

Pantetheine-phosphate adenylyltransferase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

164

S=738 I=88 E=2.09951e-80

Putative uncharacterized protein kdtB - Xanthomonas albilineans

Pubmed 16102911,

 

prodomImg

Iprscan IPR001980 [PR01020]

117

139

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

25

46

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

54

78

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

7

25

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

90

106

Coenzyme A biosynthesis protein

Iprscan IPR014729 [G3DSA:3.40.50.620]

7

164

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR21342]

6

167

-

Iprscan IPR004820 [PF01467]

10

139

Cytidylyltransferase

Iprscan IPR004821 [TIGR00125]

8

68

Cytidyltransferase-related

Iprscan IPR001980 [TIGR01510]

8

162

Coenzyme A biosynthesis protein

Iprscan [SSF52374]

4

161

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YWMpC0pD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

437 hits
trembl

TrEMBL ncbi-blastp

500 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

11 hits