Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2703uppYP_364434.1uracil phosphoribosyltransferase

upp XCV2703
XCV2702
XCV2702
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2704
XCV2704
ID upp
AC YP_364434.1
LT XCV2703
SY
OR NC_007508 from 3062790 to 3063422 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE uracil phosphoribosyltransferase
IP Uracil phosphoribosyl transferase
CL
EC
GO Biological Process: nucleoside metabolic process (GO:0009116)
Biological Process: uracil salvage (GO:0006223)
Molecular Function: uracil phosphoribosyltransferase activity (GO:0004845)
PM
AN
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MKIVEVRHPLVQHKIGLLRDAALSTKGFRELVTELGTLLAYEATANLDTE
SHTQPGWAGPVTVQRIAGAKITLVPILRAGLGMLPGVLALIPAARVSVVG
LQRDEETLQPVPYFERLTGRLEERDALILDPMLATGGTLMATIDMLKRAG
ARRIKGIFLVAAPEGLKALEAVHPDVEVYTAAIDDHLNDKGYILPGLGDA
GDRIFGTRLE
pubmed

1

208

S=743 I=65 E=9.57736e-82

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 1371255

 

prodomImg

pubmed

6

208

S=578 I=55 E=1.14103e-61

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 7961396

 

prodomImg

pubmed

2

208

S=560 I=53 E=1.64287e-59

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 9268683,12037295

 

prodomImg

pubmed

6

208

S=549 I=49 E=3.21219e-58

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 8393068,8331080

 

prodomImg

pubmed

2

208

S=549 I=50 E=3.29732e-58

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 11832506

 

prodomImg

pubmed

2

208

S=540 I=51 E=4.75151e-57

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 7798145

 

prodomImg

pubmed

2

208

S=523 I=49 E=5.31289e-55

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 10510230

 

prodomImg

pubmed

1

208

S=472 I=46 E=8.10389e-49

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 14762060

 

prodomImg

pubmed

1

208

S=460 I=44 E=2.40793e-47

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 12949158

 

prodomImg

pubmed

8

208

S=455 I=46 E=8.67482e-47

Uracil phosphoribosyltransferase EC=2.4.2.9 ; Glycosyltransferase Magnesium

Pubmed 12466555

 

prodomImg

sp

1

210

S=1056 I=99 E=8.82483e-120

Uracil phosphoribosyltransferase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

210

S=1042 I=98 E=4.05492e-118

Uracil phosphoribosyltransferase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

210

S=1042 I=98 E=4.05492e-118

Uracil phosphoribosyltransferase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

210

S=1040 I=97 E=8.14521e-118

Uracil phosphoribosyltransferase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

208

S=775 I=68 E=9.77626e-86

Uracil phosphoribosyltransferase - Mannheimia succiniciproducens (strain MBEL55E)

 

prodomImg

trembl

1

210

S=1043 I=97 E=3.54857e-117

Uracil phosphoribosyltransferase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

210

S=1042 I=98 E=4.52976e-117

Upp protein - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

210

S=1039 I=97 E=9.92798e-117

Uracil phosphoribosyltransferase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.40.50.2020]

6

208

-

Iprscan [PTHR10285]

1

207

-

Iprscan [PTHR10285:SF1]

1

207

-

Iprscan IPR000836 [PF00156]

17

179

Phosphoribosyltransferase

Iprscan IPR005765 [TIGR01091]

2

208

Uracil phosphoribosyl transferase

Iprscan [SSF53271]

3

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 44qy2lf8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

31 hits
swiss-prot

Swiss-Prot ncbi-blastp

346 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits