Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2679fruBYP_364410.1multiphosphoryl transfer protein FruB

fruB XCV2679
XCV2678
XCV2678
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2680
XCV2680
ID fruB
AC YP_364410.1
LT XCV2679
SY
OR NC_007508 from 3030990 to 3033611 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE multiphosphoryl transfer protein FruB
IP Phosphotransferase system, phosphocarrier HPr protein-like; Phosphotransferase system, PEP-utilising enzyme, N-terminal; Pyruvate/Phosphoenolpyruvate kinase, catalytic core; Phosphotransferase/anion transporter
CL
EC
GO Biological Process: transport (GO:0006810)
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: phosphoenolpyruvate-protein phosphotransferase activity (GO:0008965)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)
Molecular Function: catalytic activity (GO:0003824)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 873 aa
 
........10........20........30........40........50
| | | | |
MLTRKHYSVFVHRTLTWIVGTFPLYFPARPHPEPALSSPSPAPVTPDLVC
LRASARDKDDAIAQAAQLLVAAGCVAPGYDASMRRREGLANTFLGHGLAI
PHGVGEDRHLVRRDGIAVLQLTDGVEWNPGQITRLVVGIAAQSDTHITLL
RRLTRLIQDPAQLETLFSTDDPGVIVAALTGDRAPETNAAPATDLAETFE
WTIAYPSGLHARPATRWAETARGFSARAQVRAGDQAADAKSLVGLLQLGL
RAGDSITVSAEGSDAAELLRRLRAVMDSLTAQEKADAERAAQRRAAPVAG
WTPPQAQPAIVGIGASPGVAIGIVHRLRAAQTEVADQPVGLGDGGALLHD
ALTRTRQQLAAIQDDTQRRLGASDAAIFKAQAELLNDTDLITRTCQLMVE
GHGVAWSWHQAVEQIASGLAALGNPVLAGRAADLRDVGRRVLAQLDPAAA
GAGLTDLPEQPCILLAGDLSPSDTANLDTARVLGLATAQGGPTSHTAILS
RTLGLPALVAAGGQLLEIEDGVTAIIDGSSGRLYIDPSEQDLDAARTHIA
EQQAIREREAAQRALPAETTDGHHIDIGANVNLPDQVAMALTQGAEGVGL
MRTEFLFLESGRTPSEDEQHATYLAMAQALDGRPLIVRALDIGGDKQVAH
LELPHEENPFLGVRGARLLLRRPDLLEPQLRALYRAAKDGARLSIMFPMI
TSVPELVALRAICARLRADLDAPEVPIGIMIEVPAAAAQADVLARHADFF
SIGTNDLTQYVLAIDRQNPELAAEADSLHPAVLRMIRSTIDGARKHDRWV
GVCGGLAGDAFGASLLAGLGVQELSMTPNDIPAVKARLRGAALSQLQHLA
EQALACETAEQVRALEAKREDKA
xansp

YP_364856.1 lcl|ptsI-XCV3125

312

854

S=555 I=32 E=2.89056e-60

enzyme I of the phosphotransferase system

xansp

YP_363933.1 lcl|ppsA-XCV2202

692

838

S=146 I=28 E=1.22156e-10

phosphoenolpyruvate synthase

pubmed

47

873

S=3386 I=82 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 7496537

 

prodomImg

pubmed

47

866

S=1389 I=41 E=3.66667e-159

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 2193161

 

prodomImg

pubmed

312

865

S=896 I=35 E=1.97874e-99

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Cytoplasm Magnesium Metal-binding Phosphotransferase Sugar trans

Pubmed 15670601

 

prodomImg

pubmed

310

868

S=818 I=35 E=6.15399e-90

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1655788

 

prodomImg

pubmed

310

868

S=815 I=35 E=1.44622e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 2457575,2960675

 

prodomImg

pubmed

307

862

S=812 I=34 E=3.06108e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7670643

 

prodomImg

pubmed

312

865

S=808 I=32 E=9.76066e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

310

865

S=790 I=32 E=1.41766e-86

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 15590099

 

prodomImg

pubmed

313

862

S=785 I=33 E=5.62136e-86

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 12855720

 

prodomImg

pubmed

310

862

S=774 I=32 E=1.17851e-84

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1551842,1901791

 

prodomImg

sp

47

873

S=3386 I=82 E=0

Multiphosphoryl transfer protein - Xanthomonas campestris pv. campestris

Pubmed 7496537,1655739,

 

prodomImg

sp

47

866

S=1389 I=41 E=2.32581e-159

Multiphosphoryl transfer protein - Rhodobacter capsulatus (Rhodopseudomonas capsulata)

Pubmed 2193161,

 

prodomImg

sp

310

868

S=851 I=34 E=3.43647e-94

Phosphoenolpyruvate-protein phosphotransferase - Bacillus halodurans

 

prodomImg

sp

307

862

S=819 I=34 E=2.90214e-90

Phosphoenolpyruvate-protein phosphotransferase - Bacillus sp. (strain S)

 

prodomImg

sp

310

868

S=818 I=35 E=3.90354e-90

Phosphoenolpyruvate-protein phosphotransferase - Salmonella typhimurium

Pubmed 1655788,3290198,2497295,

 

prodomImg

trembl

47

873

S=3505 I=86 E=0

Multiphosphoryl transfer protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

19

873

S=3441 I=82 E=0

Multiphosphoryl transfer protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

47

873

S=3405 I=83 E=0

Multiphosphoryl transfer protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan [PD000940]

579

833

-

Iprscan [PD001689]

51

169

-

Iprscan [PD002238]

206

276

-

Iprscan IPR005698 [PR00107]

208

224

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

233

248

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR005698 [PR00107]

248

265

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [PR01736]

599

618

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

748

763

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

765

780

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

801

813

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR008731 [G3DSA:1.10.274.10]

346

445

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [G3DSA:3.20.20.60]

556

865

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR000032 [G3DSA:3.30.1340.10]

196

280

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR002178 [G3DSA:3.40.930.10]

44

183

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan [PTHR22931]

310

865

-

Iprscan [PTHR22931:SF10]

310

865

-

Iprscan IPR002178 [PF00359]

42

182

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR005698 [PF00381]

196

279

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR008279 [PF00391]

451

531

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PF02896]

556

843

PEP-utilizing enzyme

Iprscan IPR008731 [PF05524]

310

431

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR005698 [TIGR01003]

196

277

Phosphotransferase system, phosphocarrier HPr protein

Iprscan IPR006318 [TIGR01417]

310

867

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR001020 [PS00369]

208

215

Phosphotransferase system, HPr histidine phosphorylation site

Iprscan IPR008279 [PS00370]

490

501

PEP-utilising enzyme, mobile region

Iprscan IPR002178 [PS00372]

87

103

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR002114 [PS00589]

234

249

Phosphotransferase system, HPr serine phosphorylation site

Iprscan IPR000121 [PS00742]

748

766

PEP-utilizing enzyme

Iprscan IPR002178 [PS51094]

42

182

Phosphotransferase system, phosphoenolpyruvate-dependent sugar EIIA 2

Iprscan IPR000032 [PS51350]

196

288

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR008731 [SSF47831]

327

448

Phosphotransferase system, PEP-utilising enzyme, N-terminal

Iprscan IPR015813 [SSF51621]

554

851

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

429

555

PEP-utilising enzyme, mobile region

Iprscan IPR000032 [SSF55594]

197

283

Phosphotransferase system, phosphocarrier HPr protein-like

Iprscan IPR016152 [SSF55804]

41

181

Phosphotransferase/anion transporter

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9dCzFdAS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

87 hits
swiss-prot

Swiss-Prot ncbi-blastp

125 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

35 hits