Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2657YP_364388.1putative glutamine amidotransferase

XCV2657
XCV2656
XCV2656
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2658
XCV2658
ID
AC YP_364388.1
LT XCV2657
SY
OR NC_007508 from 2994926 to 2995681 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative glutamine amidotransferase
IP Peptidase C26; Glutamine amidotransferase type 1
CL
EC
GO Biological Process: glutamine metabolic process (GO:0006541)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 251 aa
 
........10........20........30........40........50
| | | | |
MAVVPLVGLPTDRILQGPHPFLAAGEKYIRAVIEAAAAMPVLLPSLQPAL
DAGAWLERLDGLLLTGAVSNVEPHHYSDEPSWEGNPHDPARDATILALIP
QALARGLPVLAICRGLQEVNVALGGRLHQRVHDVPGLADHREDRGTPIDM
QYGPAHVVHLHPGGWLAGMSDSAQVWVNSLHGQGIATLAEGLLIEATAPD
GLIEAFRGSGPGFLLAVQWHPEWRVTQHPFYRAIFQAFGEACRQYAARRG
K
pubmed

19

251

S=520 I=45 E=1.47582e-54

Glutamine amidotransferase ; Plasmid

Pubmed 15240330

 

prodomImg

pubmed

6

245

S=354 I=39 E=2.02147e-34

Putative glutamine amidotransferase

Pubmed 11679318,14711685

 

prodomImg

pubmed

5

235

S=270 I=34 E=3.26652e-24

Putative uncharacterized protein orf201

Pubmed 11807057

 

prodomImg

pubmed

20

235

S=251 I=34 E=6.10926e-22

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

235

S=248 I=36 E=1.37446e-21

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

235

S=248 I=35 E=1.43571e-21

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

242

S=184 I=37 E=7.54657e-14

Putative glutamine amidotransferase

Pubmed 12446651,12598647

 

prodomImg

pubmed

1

192

S=176 I=30 E=6.61591e-13

Putative glutamine amidotransferase-like protein yvdE homolog

Pubmed 1674656

 

prodomImg

pubmed

1

133

S=147 I=26 E=2.5271e-09

Putative glutamine amidotransferase-like protein RP404

Pubmed 11030655

 

prodomImg

pubmed

155

243

S=142 I=30 E=1.07444e-08

Putative glutamine amidotransferase-like protein RP404

Pubmed 11030655

 

prodomImg

sp

5

251

S=455 I=41 E=6.3599e-47

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Escherichia coli O157:H7

 

prodomImg

sp

5

251

S=454 I=40 E=1.06378e-46

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Shigella sonnei (strain Ss046)

 

prodomImg

sp

5

251

S=454 I=40 E=1.06378e-46

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Escherichia coli (strain K12)

Pubmed 15590624,

 

prodomImg

sp

5

251

S=434 I=40 E=2.26754e-44

Gamma-glutamyl-gamma-aminobutyrate hydrolase - Shigella flexneri

 

prodomImg

sp

1

242

S=267 I=32 E=3.93028e-24

Putative glutamine amidotransferase-like protein yvdE - Lactococcus lactis subsp. lactis (Streptococcus lactis)

 

prodomImg

trembl

1

251

S=1253 I=97 E=1.61893e-142

Glutamine amidotransferase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

251

S=1179 I=90 E=1.49856e-133

Glutamine amidotransferase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

251

S=1179 I=90 E=1.49856e-133

Glutamine amidotransferase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR011702 [PR00096]

108

119

Glutamine amidotransferase superfamily

Iprscan IPR011702 [PR00096]

216

229

Glutamine amidotransferase superfamily

Iprscan [G3DSA:3.40.50.880]

5

222

-

Iprscan [PTHR11922]

144

222

-

Iprscan [PTHR11922]

84

128

-

Iprscan [PTHR11922]

84

222

-

Iprscan IPR011697 [PF07722]

5

222

Peptidase C26

Iprscan IPR017926 [PS51273]

18

248

Glutamine amidotransferase type 1

Iprscan [SSF52317]

1

246

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3vkgaWdD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits