Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2656glnA2YP_364387.1putative glutamine synthetase

glnA2 XCV2656
XCV2655
XCV2655
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2657
XCV2657
ID glnA2
AC YP_364387.1
LT XCV2656
SY
OR NC_007508 from 2993534 to 2994919 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative glutamine synthetase
IP Glutamine synthetase type I
CL
EC
GO Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: glutamine biosynthetic process (GO:0006542)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)
PM
AN
SQ 461 aa
 
........10........20........30........40........50
| | | | |
MSIRTRSRKTPSKQPESALRRWLKERSITEVECLVPDITGNARGKIIPAD
KFSHDYGTRLPEGIFATTVTGDFPDDYYALTSPSDSDMHLRPDASTVRMV
PWAADPTAQVIHDCYTKDGQPHELAPRNVLRRVLDAYAQAKLQPVVAPEL
EFFLVQKNTDPDFPLLPPAGRSGRPETARQSYSIDAVNEFDPILDLMYDY
CDAMELDVDTLIHESGAAQLEVNFTHADPMSRADQVFLFKRTMREAALRH
GVYATFLAKPMETEPGSAMHIHQSLLHAGTGKNVFSGKREGGFSDTFAHY
LGGLQKYIPMAMGLLAPNVNSYRRLMFGEVSPSNVLWGFDNRTCGLRVPI
DAPQNMRVESRFAGSDANPYLAMAATLACGLLGIGEKLEPTAPISSNGKE
QGYDLPRSLGEALDELEGCEALQEMLGRRFVRAYISVKRKEYETFFRVIS
SWEREFLLLNV
xansp

YP_364389.1 lcl|glnA3-XCV2658

31

441

S=593 I=35 E=3.86253e-65

putative glutamine synthase

xansp

YP_361919.1 lcl|glnA-XCV0188

84

445

S=309 I=28 E=1.02327e-30

glutamine synthetase, type I

pubmed

22

461

S=579 I=33 E=2.27635e-61

Glutamine synthetase

Pubmed 17991023

 

prodomImg

pubmed

85

451

S=514 I=35 E=1.86653e-53

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 9172372

 

prodomImg

pubmed

25

449

S=511 I=33 E=4.78605e-53

Glutamine synthetase 1 EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 8098326

 

prodomImg

pubmed

25

449

S=501 I=33 E=6.48847e-52

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 7916055

 

prodomImg

pubmed

47

305

S=501 I=40 E=6.71874e-52

Branched-chain keto acid dehydrogenase

Pubmed 2211503

 

prodomImg

pubmed

12

455

S=480 I=30 E=2.59102e-49

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2906311,2565853

 

prodomImg

pubmed

19

453

S=471 I=31 E=2.58886e-48

Gamma-glutamylisopropylamide synthetase

Pubmed 11976110

 

prodomImg

pubmed

85

455

S=471 I=33 E=2.95057e-48

Glutamine synthetase EC=6.3.1.2 ; Cytoplasm Ligase Nucleotide-binding

Pubmed 2572584

 

prodomImg

pubmed

85

453

S=470 I=34 E=3.96869e-48

Glutamine synthetase

Pubmed 16980483

 

prodomImg

pubmed

19

453

S=469 I=31 E=4.72473e-48

Glutamine synthetase type I EC=6.3.1.2 ; Ligase

Pubmed 15933046

 

prodomImg

sp

19

460

S=629 I=36 E=1.20814e-67

Gamma-glutamylputrescine synthetase - Escherichia coli (strain K12)

Pubmed 15590624,

 

prodomImg

sp

26

451

S=562 I=35 E=1.65698e-59

Glutamine synthetase - Pyrococcus abyssi

 

prodomImg

sp

26

451

S=547 I=35 E=1.2735e-57

Glutamine synthetase - Pyrococcus horikoshii

 

prodomImg

sp

85

451

S=514 I=35 E=1.18374e-53

Glutamine synthetase - Pyrococcus kodakaraensis (Thermococcus kodakaraensis)

Pubmed 9172372,

 

prodomImg

sp

25

449

S=511 I=33 E=3.03527e-53

Glutamine synthetase 1 - Pyrococcus woesei

Pubmed 8098326,

 

prodomImg

trembl

1

461

S=2456 I=99 E=0

Glutamine synthetase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

461

S=2413 I=98 E=0

Glutamine synthetase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

461

S=2411 I=97 E=0

Glutamine synthetase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD001057]

192

439

-

Iprscan [G3DSA:3.10.20.70]

12

118

-

Iprscan IPR014746 [G3DSA:3.30.590.10]

126

458

Glutamine synthetase/guanido kinase, catalytic region

Iprscan [PTHR20852]

31

459

-

Iprscan [PTHR20852:SF7]

31

459

-

Iprscan IPR008146 [PF00120]

123

384

Glutamine synthetase, catalytic region

Iprscan IPR008147 [PF03951]

84

117

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PS00181]

259

274

Glutamine synthetase, catalytic region

Iprscan IPR008147 [SSF54368]

15

123

Glutamine synthetase, beta-Grasp

Iprscan [SSF55931]

123

458

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one MDlydjMP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

300 hits
swiss-prot

Swiss-Prot ncbi-blastp

77 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits