Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2539YP_364270.1putative alpha-amino acid ester hydrolase

XCV2539
XCV2538
XCV2538
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2540
XCV2540
ID
AC YP_364270.1
LT XCV2539
SY
OR NC_007508 from 2863885 to 2865798 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative alpha-amino acid ester hydrolase
IP CocE/NonD hydrolase; Peptidase S15, Lactococcus X-Pro dipeptidyl-peptidase; Galactose-binding like
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: proteolysis (GO:0006508)
Molecular Function: hydrolase activity (GO:0016787)
Molecular Function: dipeptidyl-peptidase activity (GO:0008239)
Molecular Function: aminopeptidase activity (GO:0004177)
PM
AN
SQ 637 aa
 
........10........20........30........40........50
| | | | |
MRRLAACLLATAIAAATGSAWAQTSPMTPDITGKPFVAADASNDYIKREV
MIPMRDGVKLHTVIVLPKGARNAPIMLTRTPYDASGRTERLASPHMKDLL
SAGDDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHATDA
WDTIDWLVKNVKESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPM
IDGWMGDDWFNYGAFRQVNFDYFTGQLSKRGKGAGIARQGHDDYSNFLQA
GSAGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTPLKVPTM
WLQGLWDQEDMWGAIHSYAAMEPRDQRNTLNYLVMGPWRHSQVNYDGSAL
GALNFEGDTARQFRSEVLRPFLDQYLVDGAPKADTPPVFIYNTGENHWDR
LKAWPRSCDKGCASSSRPLYLQAGGKLSFQQPVAGQAGFEEYVSDPAKPV
PFVPRPVDFADRAMWTTWLVHDQRFVDGRPDVLTFVTEPLTEPLQIAGAP
EVHLQASTSGSDSDWVVKLIDVYPEEMASNPKMGGYELPVSLAIFRGRYR
ESFSTPKPLASNQPLAFQFGLPTANHTFQPGHRVMVQVQSSLFPLYDRNP
QTYVPNIFFAKPGDYQKATQRVYVSPEQPSYISLPVR
pubmed

1

637

S=3235 I=95 E=0

Glutaryl-7-ACA acylase

Pubmed 12387744

 

prodomImg

pubmed

30

636

S=1988 I=61 E=0

Alpha-amino acid ester hydrolase EC=3.1.1.43

Pubmed 11772629

 

prodomImg

pubmed

43

636

S=458 I=28 E=1.74403e-46

Cocaine esterase EC=3.1.1.- ; Cytoplasm Hydrolase

Pubmed 10698749,11742345

 

prodomImg

pubmed

46

636

S=395 I=30 E=7.18149e-39

Glutaryl 7-ACA acylase ; Signal

Pubmed 1744041

 

prodomImg

pubmed

472

636

S=180 I=32 E=7.27664e-13

7-beta-(4-carboxybutanamido)cephlosporanic acid acylase homolog

Pubmed 11157924

 

prodomImg

pubmed

295

605

S=163 I=27 E=9.43628e-11

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

pubmed

46

196

S=137 I=30 E=1.25507e-07

Putative diester hydrolase

Pubmed 10650222

 

prodomImg

sp

43

636

S=458 I=28 E=1.10559e-46

Cocaine esterase - Rhodococcus sp. (strain MB1 Bresler)

Pubmed 10698749,11742345,12369817,

 

prodomImg

trembl

1

637

S=3235 I=95 E=0

Glutaryl-7-ACA acylase - Xanthomonas axonopodis pv. citri

Pubmed 12387744,

 

prodomImg

trembl

1

637

S=3235 I=95 E=0

Alpha-amino acid ester hydrolase - Xanthomonas campestris pv. citri

 

prodomImg

trembl

1

637

S=3187 I=93 E=0

Glutaryl-7-ACA acylase - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [G3DSA:2.60.120.260]

403

636

-

Iprscan [G3DSA:3.40.50.1820]

11

402

-

Iprscan IPR000383 [PF02129]

56

342

Peptidase S15

Iprscan IPR013736 [PF08530]

369

633

Peptidase S15/CocE/NonD, C-terminal

Iprscan IPR005674 [TIGR00976]

52

637

CocE/NonD hydrolase

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan IPR008979 [SSF49785]

398

637

Galactose-binding like

Iprscan [SSF53474]

20

404

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hOGX1ac7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

182 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits