Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2497cmkYP_364228.1cytidylate kinase

cmk XCV2497
XCV2496
XCV2496
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2498
XCV2498
ID cmk
AC YP_364228.1
LT XCV2497
SY
OR NC_007508 from 2818494 to 2819177 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE cytidylate kinase
IP Cytidylate kinase
CL
EC
GO Molecular Function: cytidylate kinase activity (GO:0004127)
Molecular Function: ATP binding (GO:0005524)
nucleotide and nucleic acid metabolic process (GO:0006139)
PM
AN
SQ 227 aa
 
........10........20........30........40........50
| | | | |
MTDLSPVLTIDGPSGAGKGTVSRIVAARLGWHYLDSGALYRAVGVAASWA
DLDVSDPAALVRCTFDTRVEFDDAGEAGLRVLVNGADATSELRLETTGAL
ASAIAAIPEVRSALKERQRAFRRAPGLVADGRDMGTVIFPDAAYKVFLTA
SAEERAGRRHKQLMEKGVSVIFDDLLREIMARDARDAQRVVAPLRPAEDA
VLIDTSGMGIEDVVQRVVGLLADRAPL
Hamap KCY_MF_00238 raw_score=3984 norm_score=30.665

Cytidylate kinase [cmk].

pubmed

1

219

S=513 I=48 E=9.1591e-54

Cytidylate kinase ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17400574

 

prodomImg

pubmed

1

218

S=506 I=49 E=6.98407e-53

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 6384724

 

prodomImg

pubmed

4

220

S=436 I=45 E=1.95795e-44

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17468768

 

prodomImg

pubmed

8

222

S=384 I=36 E=3.87935e-38

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10217496

 

prodomImg

pubmed

8

218

S=377 I=37 E=2.3996e-37

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 7704259

 

prodomImg

pubmed

6

218

S=360 I=42 E=3.30761e-35

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 18218977

 

prodomImg

pubmed

8

223

S=340 I=33 E=8.46703e-33

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17592475

 

prodomImg

pubmed

8

224

S=327 I=36 E=3.44347e-31

Cytidylate kinase EC=2.7.4.14 ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 10484179

 

prodomImg

pubmed

10

221

S=325 I=36 E=4.79604e-31

Cytidylate kinase ; ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 17449683

 

prodomImg

pubmed

6

220

S=310 I=39 E=3.49819e-29

Bifunctional pantoate ligase/cytidylate kinase EC=6.3.2.1 EC=2.7.4.14 ; ATP-binding Cytoplasm Multifunctional enzyme Nucleotide-binding Pantot

Pubmed 9617794

 

prodomImg

sp

1

226

S=1045 I=92 E=2.25954e-118

Cytidylate kinase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

226

S=1028 I=90 E=2.46127e-116

Cytidylate kinase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

226

S=1028 I=90 E=2.46127e-116

Cytidylate kinase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

sp

1

226

S=1021 I=90 E=1.67568e-115

Cytidylate kinase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

226

S=1021 I=90 E=1.67568e-115

Cytidylate kinase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

226

S=1028 I=90 E=2.78642e-115

Cytidylate kinase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

226

S=1021 I=90 E=2.088e-114

Complete genome, strain B100 - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

221

S=874 I=78 E=1.21902e-96

Cytidylate kinase - Stenotrophomonas maltophilia R551-3

 

prodomImg

Iprscan [PD000657]

8

47

-

Iprscan [G3DSA:3.40.50.300]

1

225

-

Iprscan [PTHR21299]

18

224

-

Iprscan IPR003136 [PTHR21299:SF2]

18

224

Cytidylate kinase

Iprscan IPR011994 [PF02224]

61

219

Cytidylate kinase region

Iprscan IPR003136 [TIGR00017]

4

221

Cytidylate kinase

Iprscan [SSF52540]

6

223

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TwiXb5LO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

352 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits