Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2333YP_364064.1putative Zn-dependent alcohol dehydrogenase

XCV2333
XCV2332
XCV2332
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2334
XCV2334
ID
AC YP_364064.1
LT XCV2333
SY
OR NC_007508 from 2663116 to 2664144 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative Zn-dependent alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing
CL
EC
GO Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 342 aa
 
........10........20........30........40........50
| | | | |
MKTTYRAMQVTRPGFLELVERPAPLPGIGEVLIEVEACGICGADASDIER
ADPALQPPRVPGHEVVGRIAALGEHTPSIWKVGQRVGVGRMGGHCNECVQ
CRQGRFQLCLNQPITGASRDGGYAEMMLARATGLVSIPDELDAEEAAPIL
CAGIATFNALKKCGAQAGDTVAVLGIGGLGHMALQYARRMGFKVIAIGRG
SDIAQDALKLGAHLYIDTNEEDATARLKSLGGAQAIVTMIDHAETVSGLL
AGLAPEGRLVVLNPSKQPLQVPAGLLVGGQRSILGSITGTPYENEKTLNF
SVLADVRPWIETMPLEKAYDAYQRMKSGDVKFRMVLTMNRPD
xansp

YP_361765.1 lcl|XCV0034

18

342

S=312 I=29 E=2.98551e-31

Zinc-containing alcohol dehydrogenase superfamily protein

xansp

YP_362783.1 lcl|tdh-XCV1052

16

214

S=195 I=31 E=4.36851e-17

L-threonine 3-dehydrogenase

xansp

YP_362575.1 lcl|XCV0844

121

338

S=144 I=28 E=6.49137e-11

putative quinone oxidoreductase

xansp

YP_363810.1 lcl|XCV2079

30

199

S=144 I=29 E=7.6609e-11

Zinc-containing alcohol dehydrogenase superfamily protein

xansp

YP_361916.1 lcl|XCV0185

22

262

S=137 I=26 E=4.94985e-10

putative alcohol dehydrogenase

xansp

YP_364778.1 lcl|XCV3047

122

328

S=128 I=26 E=5.25696e-09

putative alcohol dehydrogenase

xansp

YP_366101.1 lcl|XCV4370

103

320

S=124 I=26 E=1.6188e-08

putative nuclear receptor binding factor-like protein

xansp

YP_362519.1 lcl|XCV0788

6

336

S=118 I=23 E=8.70943e-08

putative alcohol dehydrogenase class III

pubmed

16

340

S=480 I=37 E=1.83366e-49

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8049268

 

prodomImg

pubmed

16

339

S=472 I=37 E=1.3503e-48

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8020473

 

prodomImg

pubmed

9

339

S=471 I=36 E=2.1064e-48

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 1735726,4578954

 

prodomImg

pubmed

9

342

S=463 I=36 E=1.66319e-47

Thermostable alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 18436321

 

prodomImg

pubmed

16

338

S=430 I=34 E=1.85659e-43

Zn-dependent alcohol dehydrogenase

Pubmed 18004300

 

prodomImg

pubmed

16

338

S=414 I=36 E=1.57054e-41

Alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15152088

 

prodomImg

pubmed

17

337

S=398 I=34 E=1.58164e-39

Zn-dependent alcohol dehydrogenase

Pubmed 14528002,17918933

 

prodomImg

pubmed

4

340

S=395 I=33 E=2.98899e-39

Alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 17072683

 

prodomImg

pubmed

5

339

S=390 I=31 E=1.4358e-38

NADP-dependent alcohol dehydrogenase C EC=1.1.1.2 ; Metal-binding Oxidoreductase Zinc

Pubmed 1427101

 

prodomImg

pubmed

3

336

S=388 I=31 E=2.57508e-38

Alcohol dehydrogenase, class C EC=1.1.1.2 ; Metal-binding Oxidoreductase Zinc

Pubmed 11257547

 

prodomImg

sp

16

340

S=480 I=37 E=1.16487e-49

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

16

339

S=472 I=37 E=8.57804e-49

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8020473,

 

prodomImg

sp

9

339

S=471 I=36 E=1.33813e-48

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

sp

5

339

S=390 I=31 E=9.12123e-39

NADP-dependent alcohol dehydrogenase C - Mycobacterium tuberculosis

 

prodomImg

sp

5

339

S=390 I=31 E=9.12123e-39

NADP-dependent alcohol dehydrogenase C - Mycobacterium bovis

Pubmed 1427101,

 

prodomImg

trembl

1

342

S=1724 I=96 E=0

Alcohol dehydrogenase GroES domain protein - Acidovorax sp. (strain JS42)

 

prodomImg

trembl

1

339

S=1369 I=77 E=2.08239e-156

Alcohol dehydrogenase GroES domain protein - Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))

 

prodomImg

trembl

1

339

S=1360 I=76 E=2.75022e-155

Alcohol dehydrogenase GroES domain protein - Burkholderia ambifaria (strain MC40-6)

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

3

187

-

Iprscan IPR002085 [PTHR11695]

16

338

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF38]

16

338

-

Iprscan [seg]

82

93

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 93nWMDeo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

277 hits
swiss-prot

Swiss-Prot ncbi-blastp

268 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits