Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2303YP_364034.1dihydrolipoamide dehydrogenase

XCV2303
XCV2302
XCV2302
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2304
XCV2304
ID
AC YP_364034.1
LT XCV2303
SY
OR NC_007508 from 2636276 to 2637643 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE dihydrolipoamide dehydrogenase
IP Peptidase, cysteine peptidase active site; Dihydrolipoamide dehydrogenase; FAD/NAD-linked reductase, dimerisation
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: proteolysis (GO:0006508)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: cysteine-type endopeptidase activity (GO:0004197)
PM
AN
SQ 455 aa
 
........10........20........30........40........50
| | | | |
MQARKVDIAIIGAGTAGITAFHALKAAGKDVVLIDRGPLGTTCARVGCMP
SKAALHAGMRWTTAKELPAGVTLSAQGPQALWRHTRQTRDALAGAAAERT
RKAVGENLIMAEARFVAPGTLEVGDQRIEAKAFIVATGSHPVVPKSLDGA
ASHILTTDTLFEQKELPQRLGILGLGAIGLELGLALSRLDVQVIGADQQD
TIGGIQDPEVQDRALSRFGGEFPMWLGAPVEVTLAGDKVRMRTDKHEALV
DRLLVVTGRQPNTEALNLQAAGILLDKAGRPNIDASTMQASDAPIFFAGD
VQPDRPLMHEAADEGQMAAQAALTRLRGEQWQGAPRRVPISILFTDPDVC
AVGMSYQAAMKKDAVVGIAEGSGNGRSKILGAQDNLLRIYVEPGTGLLLG
ASMLLTQGEHLAHLLAWAIQAKQTVNDLLTMPFYHPSIEEMLQSALKSAS
QQLNP
xansp

YP_365508.1 lcl|lpdA-XCV3777

23

440

S=167 I=24 E=1.56298e-13

dihydrolipoamide dehydrogenase

pubmed

23

428

S=305 I=26 E=4.25728e-28

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 11302791

 

prodomImg

pubmed

23

428

S=305 I=26 E=4.25728e-28

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 15358427

 

prodomImg

pubmed

23

428

S=305 I=26 E=4.25728e-28

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 15358427

 

prodomImg

pubmed

23

428

S=305 I=26 E=4.25728e-28

Mercuric reductase EC=1.16.1.1 ; FAD Flavoprotein resistance Mercury Metal-binding NADP Oxidoreductase Plasmid Redox-active center

Pubmed 3037534

 

prodomImg

pubmed

23

428

S=302 I=26 E=8.70214e-28

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 15358427

 

prodomImg

pubmed

31

362

S=285 I=29 E=1.03426e-25

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 15251199

 

prodomImg

pubmed

31

362

S=285 I=29 E=1.14834e-25

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 15251199

 

prodomImg

pubmed

31

362

S=283 I=29 E=1.54458e-25

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Plasmid Redox-active center

Pubmed 9534232

 

prodomImg

pubmed

31

362

S=275 I=29 E=1.57044e-24

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Plasmid Redox-active center

Pubmed 9534232

 

prodomImg

pubmed

28

404

S=269 I=28 E=7.60988e-24

Mercuric reductase ; FAD Flavoprotein Oxidoreductase Redox-active center

Pubmed 17401541

 

prodomImg

sp

23

428

S=305 I=26 E=2.67958e-28

Mercuric reductase - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

sp

23

428

S=305 I=26 E=2.67958e-28

Mercuric reductase - Staphylococcus aureus

Pubmed 3037534,

 

prodomImg

sp

31

362

S=268 I=28 E=8.29587e-24

Mercuric reductase - Bacillus cereus

Pubmed 2536669,10559175,7988676,2067577,

 

prodomImg

sp

23

449

S=261 I=24 E=5.64798e-23

Dihydrolipoyl dehydrogenase - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

23

449

S=261 I=24 E=5.64798e-23

Dihydrolipoyl dehydrogenase - Staphylococcus aureus

Pubmed 1756171,

 

prodomImg

trembl

1

455

S=2127 I=91 E=0

Pyridine nucleotide-disulphide oxidoreductase dimerisation region precursor - Acidovorax sp. (strain JS42)

 

prodomImg

trembl

1

455

S=1668 I=71 E=0

Putative pyridine nucleotide-disulfide oxidoreductase, class I - Pseudomonas aeruginosa

 

prodomImg

trembl

1

455

S=1668 I=71 E=0

Pyridine nucleotide-disulphide oxidoreductase dimerisation region precursor - Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839)

 

prodomImg

Iprscan [PD000139]

137

209

-

Iprscan IPR013027 [PR00368]

133

142

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

169

194

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

251

265

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

295

302

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

7

29

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan [PR00411]

133

142

-

Iprscan [PR00411]

169

194

-

Iprscan [PR00411]

251

265

-

Iprscan [PR00411]

295

302

-

Iprscan [PR00411]

335

356

-

Iprscan [PR00411]

39

54

-

Iprscan [PR00411]

398

413

-

Iprscan [PR00411]

420

440

-

Iprscan [PR00411]

7

29

-

Iprscan IPR004099 [G3DSA:3.30.390.30]

342

446

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan [G3DSA:3.50.50.60]

3

325

-

Iprscan [PTHR22912]

9

446

-

Iprscan [PTHR22912:SF29]

9

446

-

Iprscan IPR001327 [PF00070]

169

258

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR004099 [PF02852]

338

446

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR013027 [PF07992]

7

306

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR000169 [PS00639]

20

30

Peptidase, cysteine peptidase active site

Iprscan [seg]

170

186

-

Iprscan [seg]

310

322

-

Iprscan [seg]

8

20

-

Iprscan [SSF51905]

5

322

-

Iprscan IPR016156 [SSF55424]

336

455

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one a44a4Cb4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

171 hits
swiss-prot

Swiss-Prot ncbi-blastp

117 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

28 hits