Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2251YP_363982.1competence-related DNA-transformation transporter

XCV2251
XCV2250
XCV2250
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2252
XCV2252
ID
AC YP_363982.1
LT XCV2251
SY
OR NC_007508 from 2581549 to 2584098 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE competence-related DNA-transformation transporter
IP Competence protein ComEC/Rec2
CL
EC
GO Biological Process: establishment of competence for transformation (GO:0030420)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: hydrolase activity (GO:0016787)
PM
AN
SQ 849 aa
 
........10........20........30........40........50
| | | | |
MATDSMEVSAQAAPPQMGSAVAIAAALLLGVVACAWSPTLLARMVYVGCV
CVALLGSGATVWLRPRRSALLLAGAAALFGFGTMGWQVTDALQSQLLPRN
ETRDVTVRGQIVGLPTAEQRRTRFQLRVDQAPAQPAALRGKLLQLAWYDD
FGAERIGPRAALHAGARWQLRLKLRAPRGLRNPGGFDAERQAVAQRIAAT
GYVRMPATARQIAPPQGVDAWREWMSQRIAERVGGPSAPYLRALALGDTR
GLDDMAWATLRATGLSHLIAISGFHVGLVGAFFALLVAGIWRWQPRLGTF
MPRLHAASIAALLGAAAYALLAGMALPTVRTVLMIAVVALARVLRRRAST
AHVLSLALLAVLLWDPLSVLVAGFWLSFAGVAWLVWCLPSDDRAIVRGFL
SAQTVATVGLLPLTVSLFGQASLVGPFANLVAIPWWTFVVVPLCLLGTAL
EAIYPGTGVWAWQLAGWCFELTWPGFVWLGHTAVALWWVPESDGVALIAA
LLGAFWLLLPRATPGKSLAALLWLPLLWPDRELPTAAGEAEVHVLDVGQG
LAVLVRTQRHALLFDTGPAVRDGFDAGERVVLPALRALGVRRLDAIVLSH
ADADHAGGYAAVRTGLPVARTAAPPGAPLDVTARCRAGQQWEWDGVRFRF
LHPGVGFPYLRNQSSCVLRVETAYASALLPGDIGEIVERRLLRGRAADLR
ADLVIVPHHGSADGSQAGFIAATGARLALVSSGHGNRFGHPRAEVVQRWK
SGGAEVLDTAQAGAIRVWLGAAGLQLRERRHWQPRLWDAAERRRSAAILS
VSEQAAVLPEESNRVGAGQGRRLADGAVAVAGRDRPGDRAGASVEPAPQ
pubmed

152

785

S=336 I=24 E=1.32016e-31

Competence factor ComA

Pubmed 11425734

 

prodomImg

pubmed

538

785

S=303 I=36 E=1.39856e-27

Competence protein comA ; Cell inner membrane Transmembrane Transport

Pubmed 7934834,8830266

 

prodomImg

pubmed

165

450

S=175 I=28 E=4.93254e-12

Competence protein comA ; Cell inner membrane Transmembrane Transport

Pubmed 7934834,8830266

 

prodomImg

pubmed

533

787

S=276 I=29 E=2.50201e-24

Competence protein

Pubmed 14742218

 

prodomImg

pubmed

405

766

S=227 I=24 E=1.91654e-18

ComE operon protein 3 ; Cell membrane Competence Transmembrane Transport

Pubmed 7968523

 

prodomImg

pubmed

541

780

S=222 I=28 E=9.87145e-18

Recombination protein 2 ; Cell inner membrane Competence Transmembrane Transport

Pubmed 8063112

 

prodomImg

pubmed

168

278

S=140 I=36 E=8.08074e-08

Recombination protein 2 ; Cell inner membrane Competence Transmembrane Transport

Pubmed 8063112

 

prodomImg

pubmed

372

765

S=212 I=24 E=1.4225e-16

ComEC protein

Pubmed 15558816

 

prodomImg

pubmed

544

772

S=165 I=32 E=7.1079e-11

Competence factor ComEC

Pubmed 11425734

 

prodomImg

pubmed

167

294

S=145 I=34 E=1.85153e-08

Competence factor ComEC

Pubmed 11425734

 

prodomImg

sp

538

785

S=303 I=36 E=8.81628e-28

Competence protein comA - Neisseria gonorrhoeae

Pubmed 7934834,8830266,

 

prodomImg

sp

165

450

S=175 I=28 E=3.10939e-12

Competence protein comA - Neisseria gonorrhoeae

Pubmed 7934834,8830266,

 

prodomImg

sp

386

780

S=273 I=28 E=4.04423e-24

Uncharacterized protein ycaI - Escherichia coli (strain K12)

Pubmed 8094880,

 

prodomImg

sp

161

276

S=131 I=32 E=6.72761e-07

Uncharacterized protein ycaI - Escherichia coli (strain K12)

Pubmed 8094880,

 

prodomImg

sp

405

766

S=227 I=24 E=1.20815e-18

ComE operon protein 3 - Bacillus subtilis

Pubmed 7968523,

 

prodomImg

trembl

1

849

S=3341 I=81 E=0

Competence protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

803

S=2912 I=75 E=0

Competence protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

803

S=2911 I=75 E=0

Competence protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [G3DSA:3.60.15.10]

552

710

-

Iprscan IPR001279 [PF00753]

549

709

Beta-lactamase-like

Iprscan IPR004477 [PF03772]

244

513

ComEC/Rec2-related protein

Iprscan IPR004477 [TIGR00360]

265

443

ComEC/Rec2-related protein

Iprscan IPR004797 [TIGR00361]

94

763

Competence protein ComEC/Rec2

Iprscan [SignalP-NN(euk)]

1

42

-

Iprscan [tmhmm]

21

40

-

Iprscan [tmhmm]

269

291

-

Iprscan [tmhmm]

304

326

-

Iprscan [tmhmm]

366

388

-

Iprscan [tmhmm]

395

417

-

Iprscan [tmhmm]

432

454

-

Iprscan [tmhmm]

44

63

-

Iprscan [tmhmm]

467

489

-

Iprscan [tmhmm]

70

89

-

Iprscan [SSF56281]

521

791

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lCxk513y)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits