Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2202ppsAYP_363933.1phosphoenolpyruvate synthase

ppsA XCV2202
XCV2201
XCV2201
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2203
XCV2203
ID ppsA
AC YP_363933.1
LT XCV2202
SY
OR NC_007508 from 2531158 to 2533536 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE phosphoenolpyruvate synthase
IP Phosphoenolpyruvate synthase; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL
EC
GO Biological Process: phosphorylation (GO:0016310)
Biological Process: gluconeogenesis (GO:0006094)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: kinase activity (GO:0016301)
transferring phosphorus-containing groups (GO:0016772)
water dikinase activity (GO:0008986)
PM
AN
SQ 792 aa
 
........10........20........30........40........50
| | | | |
MNENILWLHELRLADLARVGGKNSSLGEMIGNLAGLGVSVPGGYATTAEA
FKDFIAHNDLSKRIFDKLATLDVEDVNALTLAGKEIRGWVIDAPLQPELD
RDIRTAYAQLCAENGGGDVAVAVRSSATAEDLPDASFAGQQETFLNVTGA
DDVVHKVKEVFASLYNDRAIAYRVHHGFKHEDVFLSAGVQLMVRSGVGAA
GVLFTLDTESGFRDVVFVTSSFGLGEMVVQGAVNPDEFYVYKPTLTAGKP
AILRRSLGSKAIRMVYSDVPGERVRTEDTPVELRNTFSISDEDVHELSKQ
ALVIEKHYGRPMDIEWAKDGVSGKLFIVQARPETVKSRSHATQIERFALE
AKDAKILAEGRAVGAKIGSGVARVVRSLDDMNRVQAGDVLIADMTDPDWE
PVMKRASAIVTNRGGRTCHAAIIARELGVPAVVGSGNATAVIKDGQEVTV
SCAEGDTGFIYEGKLAFERTTTDLGNMPPAPLKIMMNVANPERAFDFGQL
PNAGIGLARLEMIIASHIGVHPNALLEYDKQDADVRKKIDAKIAGYGDPV
SFYVNRLAEGIATLTASVAPNTVIVRLSDFKSNEYANLIGGSRYEPHEEN
PMIGFRGASRYVDPSFTKAFALECKAVLKVRNEMGLDNLWVMIPFVRTLE
EGRKVIEVLEQNGLKQGENGLKIIMMCELPSNALLADEFLEIFDGFSIGS
NDLTQLTLGLDRDSSIVAHLFDERNPAVKKLLSMAIKSARAKGKYVGICG
QGPSDHPELAEWLMQEGIESVSLNPDTVVDTWLRLAKLKSEG
xansp

YP_364856.1 lcl|ptsI-XCV3125

386

781

S=244 I=28 E=1.46518e-22

enzyme I of the phosphotransferase system

xansp

YP_364410.1 lcl|fruB-XCV2679

596

785

S=183 I=29 E=2.95161e-15

multiphosphoryl transfer protein FruB

pubmed

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Kinase Magnesium Metal-binding Transferase

Pubmed 16109965

 

prodomImg

pubmed

5

786

S=2819 I=66 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 17038831

 

prodomImg

pubmed

5

789

S=2775 I=65 E=0

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 1310524

 

prodomImg

pubmed

1

781

S=2063 I=50 E=0

Putative phosphoenolpyruvate synthase

Pubmed 17351032

 

prodomImg

pubmed

5

781

S=1578 I=44 E=0

Probable phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7805870

 

prodomImg

pubmed

510

787

S=1069 I=68 E=1.96161e-120

PpsA ; Kinase Magnesium Metal-binding Transferase

Pubmed 10438740

 

prodomImg

pubmed

60

778

S=1059 I=39 E=2.72984e-119

Phosphoenolpyruvate synthase EC=2.7.9.2 ; ATP-binding Kinase Magnesium Metal-binding Nucleotide-binding Transferase

Pubmed 7828869,7628701

 

prodomImg

pubmed

10

778

S=1059 I=37 E=2.95267e-119

Phosphoenolpyruvate synthase EC=2.7.9.2 ; Transferase

Pubmed 10430574

 

prodomImg

pubmed

291

530

S=835 I=66 E=4.66317e-92

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

pubmed

291

528

S=835 I=67 E=4.82867e-92

Phosphoenolpyruvate synthase

Pubmed 17189443

 

prodomImg

sp

5

786

S=2819 I=66 E=0

Phosphoenolpyruvate synthase - Neisseria meningitidis serogroup B

Pubmed 17038831,

 

prodomImg

sp

5

789

S=2775 I=65 E=0

Phosphoenolpyruvate synthase - Escherichia coli (strain K12)

Pubmed 1310524,4293109,4319237,16880,

 

prodomImg

sp

11

786

S=2606 I=65 E=0

Phosphoenolpyruvate synthase - Deinococcus radiodurans

 

prodomImg

sp

5

789

S=2284 I=55 E=0

Phosphoenolpyruvate synthase - Synechocystis sp. (strain PCC 6803)

 

prodomImg

sp

5

791

S=2232 I=52 E=0

Phosphoenolpyruvate synthase - Helicobacter pylori (Campylobacter pylori)

 

prodomImg

trembl

1

792

S=4118 I=98 E=0

Phosphoenolpyruvate synthase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

792

S=4099 I=97 E=0

Phosphoenolpyruvate synthase - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 16109965,

 

prodomImg

Iprscan [PD000940]

625

775

-

Iprscan IPR006318 [PR01736]

694

709

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

711

726

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR006318 [PR01736]

747

759

Phosphoenolpyruvate-protein phosphotransferase

Iprscan IPR015813 [G3DSA:3.20.20.60]

480

789

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR013815 [G3DSA:3.30.1490.20]

2

193

ATP-grasp fold, subdomain 1

Iprscan IPR008279 [G3DSA:3.50.30.10]

348

462

PEP-utilising enzyme, mobile region

Iprscan [PTHR22931]

8

784

-

Iprscan [PTHR22931:SF7]

8

784

-

Iprscan IPR008279 [PF00391]

377

458

PEP-utilising enzyme, mobile region

Iprscan IPR002192 [PF01326]

4

361

Pyruvate phosphate dikinase, PEP/pyruvate-binding

Iprscan IPR000121 [PF02896]

573

790

PEP-utilizing enzyme

Iprscan IPR006319 [TIGR01418]

4

790

Phosphoenolpyruvate synthase

Iprscan IPR008279 [PS00370]

414

425

PEP-utilising enzyme, mobile region

Iprscan IPR000121 [PS00742]

694

712

PEP-utilizing enzyme

Iprscan IPR015813 [SSF51621]

461

791

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR008279 [SSF52009]

342

457

PEP-utilising enzyme, mobile region

Iprscan [SSF56059]

1

386

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XPiMnukq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

126 hits
swiss-prot

Swiss-Prot ncbi-blastp

122 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits