Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2170YP_363901.1putative oxidoreductase

XCV2170
XCV2169
XCV2169
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2171
XCV2171
ID
AC YP_363901.1
LT XCV2170
SY
OR NC_007508 from 2496105 to 2497076 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
PM
AN
SQ 323 aa
 
........10........20........30........40........50
| | | | |
MFAVYAKEANVDDPLASVVVGERPEPIVQEGWVRVKVTHASLNRHDIFTL
RGMTSQEQPIPFPMILGNDAAGVLEDGTPVVLYPVLGSDDWKGDETLDPH
WHVISELVPGTMADYVAVPKRNAVPIPDGLSPLHASLLGTAWLTAYRSLF
TKSRLIPGQTLLVQGASGGMSTALIQMGRAAGFEVWVTTRNDEGAAIAER
LGANRVLRHGEALPRRVDAVVDNIGAATWADSLKAVKRGGVLVINGITTG
NIAETDVLRIFVEQIDIRGTIMGTLEEMKAMMQFVIRNNIAPEVGAVVPM
TEARDAIRNMIDGRTQGKTVFTR
xansp

YP_362575.1 lcl|XCV0844

22

321

S=230 I=31 E=2.15471e-21

putative quinone oxidoreductase

xansp

YP_362772.1 lcl|XCV1041

11

213

S=155 I=33 E=3.24995e-12

putative oxidoreductase

xansp

YP_364778.1 lcl|XCV3047

1

283

S=150 I=26 E=1.38177e-11

putative alcohol dehydrogenase

xansp

YP_361916.1 lcl|XCV0185

110

321

S=119 I=24 E=7.4805e-08

putative alcohol dehydrogenase

xansp

YP_366101.1 lcl|XCV4370

13

269

S=113 I=24 E=4.16747e-07

putative nuclear receptor binding factor-like protein

xansp

YP_361765.1 lcl|XCV0034

110

294

S=105 I=25 E=3.26202e-06

Zinc-containing alcohol dehydrogenase superfamily protein

pubmed

18

318

S=357 I=35 E=1.18956e-34

Putative NADPH:quinone oxidoreductase (Putative alcohol dehydrogenase) EC=1.1.1.1

Pubmed 9177244,9573182

 

prodomImg

pubmed

22

320

S=303 I=31 E=4.41543e-28

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

22

321

S=291 I=32 E=1.13123e-26

Putative oxidoreductase

Pubmed 15112998

 

prodomImg

pubmed

24

283

S=259 I=30 E=9.89246e-23

Putative uncharacterized protein

Pubmed 12019272

 

prodomImg

pubmed

7

321

S=213 I=25 E=3.11394e-17

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8049268

 

prodomImg

pubmed

26

319

S=211 I=25 E=6.59096e-17

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 8170370

 

prodomImg

pubmed

7

321

S=206 I=26 E=2.13859e-16

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 1735726,4578954

 

prodomImg

pubmed

26

321

S=200 I=26 E=1.25542e-15

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

26

300

S=199 I=26 E=1.70339e-15

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

7

322

S=195 I=25 E=5.19982e-15

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8020473

 

prodomImg

sp

7

321

S=213 I=25 E=1.96194e-17

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

26

319

S=211 I=25 E=4.15264e-17

Quinone oxidoreductase - Mus musculus (Mouse)

Pubmed 8170370,8645260,

 

prodomImg

sp

7

321

S=206 I=26 E=1.34742e-16

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

sp

26

321

S=200 I=26 E=7.90976e-16

Quinone oxidoreductase - Cavia porcellus (Guinea pig)

Pubmed 2777081,1420281,1370456,

 

prodomImg

sp

26

300

S=199 I=26 E=1.07323e-15

Zeta-crystallin - Bos taurus (Bovine)

Pubmed 9154917,

 

prodomImg

trembl

1

323

S=1108 I=62 E=9.27729e-125

Alcohol dehydrogenase - Stigmatella aurantiaca DW4/3-1

 

prodomImg

trembl

1

322

S=772 I=47 E=4.1988e-84

Alcohol dehydrogenase - Janibacter sp. HTCC2649

 

prodomImg

trembl

1

323

S=751 I=48 E=1.55016e-81

Alcohol dehydrogenase - Thermobifida fusca (strain YX)

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

120

298

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

17

323

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

106

323

-

Iprscan [PTHR11695:SF21]

17

323

-

Iprscan [PTHR11695:SF21]

17

84

-

Iprscan IPR013149 [PF00107]

157

287

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

30

126

Alcohol dehydrogenase GroES-like

Iprscan IPR011032 [SSF50129]

1

163

GroES-like

Iprscan IPR016040 [SSF51735]

134

292

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6UX34Fcn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

141 hits
swiss-prot

Swiss-Prot ncbi-blastp

60 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits