Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV2039YP_363770.1putative two-component system sensor-response regulator hybrid protein

XCV2039
XCV2038
XCV2038
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV2040
XCV2040
ID
AC YP_363770.1
LT XCV2039
SY
OR NC_007508 from 2320101 to 2321822 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative two-component system sensor-response regulator hybrid protein
IP Cyclic nucleotide-binding; CheY-like; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
PM
AN
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MWSPVIPPGLEIVKPTRLGAGNPELLHLVDAAASGGPPLMIFHVDIDHFA
SINENMSGEVGDQALTLAARRLQEFLGTRGKLWRHGSDEMVVVAVRRDDT
PLPEDFAEEIRQQLELPLSVLPYTLFMTGKVGISLCPEHSTSLSTLLDYA
EEASYQAAREGGNTVRLYTRNSATNAHSESIIARQIVDAIPHGELRLRYQ
PLVSARDGRIVGMEALLRWQSPTLGMLVPERFMRTAERLGVIVQIGEWVL
QNAVRQARLWRDQGFDDFSIAVNVSTLQLLRPGFFNEVMAMLQTAGVPAQ
FVTLEINESALTNNVNFVHETMANLRNEGISLSLDNFGTGDSSLSALVRY
PVDRLKIDRSFIKSAPAGSREAAIARAIIAMGHQLGMTVIANGVESQAQL
GFLRRNDCDIFQGYLFGEPMSAESAGMALRRRYLRPESFAESRPDRTLLL
LDDEENVLRSLVRLFRRDGYRILAAGNVRDAFDLLATNDVQVILSDQRMS
DMSGTEFLGRVKMLYPDTVRLVLSGYTDLATVTEAINRGAIYRFLTKPWN
DDELREHIRQAFRTHDELRNGRE
xansp

YP_363713.1 lcl|XCV1982

22

423

S=602 I=35 E=4.34542e-66

putative sensor protein

xansp

YP_364591.1 lcl|XCV2860

25

420

S=574 I=36 E=1.06403e-62

putative signalling protein

xansp

YP_364310.1 lcl|XCV2579

27

421

S=569 I=35 E=3.51321e-62

putative sensor protein

xansp

YP_363772.1 lcl|XCV2041

32

430

S=542 I=35 E=7.28925e-59

putative signal transduction protein

xansp

YP_363660.1 lcl|XCV1929

28

424

S=516 I=33 E=1.19516e-55

putative c-di-GMP phosphodiesterase or signal transduction protein

xansp

YP_363556.1 lcl|XCV1825

194

424

S=432 I=39 E=1.58035e-45

putative phosphodiesterase

xansp

YP_364754.1 lcl|XCV3023

189

420

S=397 I=38 E=3.05546e-41

two-component system response regulator

xansp

YP_363833.1 lcl|XCV2102

189

423

S=356 I=33 E=2.66972e-36

putative signal transduction protein

xansp

YP_365782.1 lcl|XCV4051

189

422

S=311 I=34 E=7.3095e-31

putative signal transduction protein

xansp

YP_364704.1 lcl|XCV2973

25

423

S=272 I=26 E=4.20266e-26

putative signal transduction protein

pubmed

420

573

S=769 I=98 E=2.69383e-84

Genes for sensor and regulator protein

Pubmed 2233675

 

prodomImg

pubmed

33

431

S=693 I=38 E=5.05267e-75

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

29

422

S=616 I=34 E=1.11845e-65

MorA

Pubmed 15489433

 

prodomImg

pubmed

40

423

S=577 I=33 E=5.4489e-61

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

35

423

S=573 I=34 E=1.57856e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

32

431

S=571 I=34 E=3.31219e-60

PDEA1

Pubmed 15042328

 

prodomImg

pubmed

28

432

S=569 I=30 E=4.4941e-60

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

15

423

S=569 I=31 E=5.25775e-60

ScrC

Pubmed 12374828

 

prodomImg

pubmed

32

431

S=569 I=34 E=5.39709e-60

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

pubmed

35

420

S=555 I=34 E=2.5904e-58

C-di-GMP phosphodiesterase A

Pubmed 9721278

 

prodomImg

sp

36

448

S=639 I=35 E=9.98267e-69

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

40

423

S=577 I=33 E=3.45285e-61

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

41

423

S=570 I=34 E=2.37135e-60

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

29

427

S=561 I=34 E=3.32895e-59

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

sp

25

444

S=510 I=30 E=5.03365e-53

Uncharacterized protein Mb1389c - Mycobacterium bovis

 

prodomImg

trembl

1

573

S=2958 I=98 E=0

C-di-GMP phosphodiesterase A - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

573

S=2951 I=98 E=0

C-di-GMP phosphodiesterase A - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

573

S=2951 I=98 E=0

C-di-GMP phosphodiesterase A - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD000039]

447

563

-

Iprscan [G3DSA:3.30.70.270]

25

176

-

Iprscan [G3DSA:3.40.50.2300]

443

570

-

Iprscan [PTHR23283]

447

567

-

Iprscan [PTHR23283]

51

567

-

Iprscan [PTHR23283]

51

59

-

Iprscan [PTHR23283:SF21]

447

567

-

Iprscan [PTHR23283:SF21]

51

567

-

Iprscan [PTHR23283:SF21]

51

59

-

Iprscan IPR001789 [PF00072]

446

559

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PF00563]

178

419

EAL

Iprscan IPR000160 [PF00990]

24

164

GGDEF

Iprscan IPR001633 [SM00052]

178

424

EAL

Iprscan IPR001789 [SM00448]

446

558

Signal transduction response regulator, receiver region

Iprscan IPR000160 [TIGR00254]

10

169

GGDEF

Iprscan IPR000595 [PS50042]

465

520

Cyclic nucleotide-binding

Iprscan IPR001789 [PS50110]

447

562

Signal transduction response regulator, receiver region

Iprscan IPR001633 [PS50883]

179

433

EAL

Iprscan IPR000160 [PS50887]

37

170

GGDEF

Iprscan IPR011006 [SSF52172]

443

570

CheY-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one oAMGHQIE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

194 hits
swiss-prot

Swiss-Prot ncbi-blastp

86 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

27 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits