Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1982YP_363713.1putative sensor protein

XCV1982
XCV1981
XCV1981
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1983
XCV1983
ID
AC YP_363713.1
LT XCV1982
SY
OR NC_007508 from 2258802 to 2260883 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative sensor protein
IP MHYT; Oxygen sensor diguanylate cyclase/c-di-GMP phosphodiesterase
CL
EC
GO
PM
AN
SQ 693 aa
 
........10........20........30........40........50
| | | | |
MVGTYNPGMVMLSLVVAVLASYTALYLAARTTASRGGIAAAWLVGGAIAM
GIWSMHFVGMLAFRLPIPVGYDLALTCYSMLAAILTSALALWLTSRADLP
SLRLGLGALLMGLGIALMHYMGMDALRMVPAIRYDPLLFGLSIAIAIGAS
AAALWIAFRLRHDGQRSSLRLIAASIMGVAIVGMHYTGMAAARFAPGSVC
GAVADTHLPLSWLTAVVVLVTLVLLMLALVISLLSRRFQQRTDVLAQSLA
KANAELALATLHDPLTRLPNRILLHEHLVQNIERAQRQGQRFAVMLINLD
GFKVINDGYGHALGDRLLVVVAERLNAHRRAHGSLARLGADEFVLVADIA
DPEDAAALAAHLVQALAVPFLVANHELRLSSSIGIALYPEDAGSEHQLLT
HADAAMTHAKHAGRNRYSFFERSMTATTRDRLQLLQELPRALELGQFVLH
YQPKYCAEDGRPIGAEALIRWQHPERGLVPPDSFIPLAERSGMIGLLGSW
VLRQACRQMRDWRQAGHGDWRVAVNLSALQLASPSLLDEVATTLSEYALA
PGQLTLEITETMAMRDAEACLRTLGQLNALGVRIAIDDFGTGYSNLLYLR
KLPAHELKIDRSFVQAMDGSAEDIAIVAAVVALAHTMRLQVVAEGVETLA
QRNTLERLGCDQLQGYLLGRPMDAERFIATVVAQRDGPRRLVS
xansp

YP_363660.1 lcl|XCV1929

261

684

S=736 I=39 E=2.87493e-82

putative c-di-GMP phosphodiesterase or signal transduction protein

xansp

YP_363772.1 lcl|XCV2041

251

691

S=687 I=39 E=2.5764e-76

putative signal transduction protein

xansp

YP_364310.1 lcl|XCV2579

245

683

S=635 I=35 E=5.47347e-70

putative sensor protein

xansp

YP_364591.1 lcl|XCV2860

262

679

S=603 I=35 E=3.58971e-66

putative signalling protein

xansp

YP_363770.1 lcl|XCV2039

275

675

S=524 I=32 E=1.55494e-56

putative two-component system sensor-response regulator hybrid protein

xansp

YP_363556.1 lcl|XCV1825

417

674

S=427 I=38 E=8.58355e-45

putative phosphodiesterase

xansp

YP_364754.1 lcl|XCV3023

438

672

S=408 I=41 E=1.66233e-42

two-component system response regulator

xansp

YP_365782.1 lcl|XCV4051

428

679

S=399 I=38 E=2.17638e-41

putative signal transduction protein

xansp

YP_364704.1 lcl|XCV2973

255

680

S=393 I=29 E=9.49848e-41

putative signal transduction protein

xansp

YP_363833.1 lcl|XCV2102

440

691

S=378 I=35 E=6.34965e-39

putative signal transduction protein

pubmed

262

679

S=837 I=41 E=2.00167e-92

MorA

Pubmed 15489433

 

prodomImg

pubmed

251

684

S=743 I=37 E=5.22042e-81

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

39

194

S=189 I=30 E=6.93553e-14

Signaling protein ykoW ; Cell membrane Transmembrane

Pubmed 11728710

 

prodomImg

pubmed

248

675

S=741 I=37 E=1.03051e-80

YkoW protein

Pubmed 10589720

 

prodomImg

pubmed

245

684

S=707 I=36 E=1.11091e-76

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

262

678

S=680 I=37 E=2.28493e-73

Putative uncharacterized protein RMe0348 (Diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(S)) ; Plasmid

Pubmed 7766206,11544228

 

prodomImg

pubmed

241

679

S=678 I=37 E=4.09797e-73

Multidomain signal-transduction protein

Pubmed 16436438

 

prodomImg

pubmed

263

689

S=665 I=37 E=1.52745e-71

Putative uncharacterized protein

Pubmed 14660379

 

prodomImg

pubmed

243

675

S=661 I=36 E=5.17701e-71

PA5017-like protein

Pubmed 17521365

 

prodomImg

pubmed

252

677

S=659 I=35 E=7.02436e-71

ScrC

Pubmed 12374828

 

prodomImg

sp

39

681

S=1505 I=49 E=1.42202e-173

Uncharacterized signaling protein PA1727 - Pseudomonas aeruginosa

 

prodomImg

sp

42

672

S=890 I=35 E=5.48886e-99

Uncharacterized signaling protein PA3311 - Pseudomonas aeruginosa

 

prodomImg

sp

251

684

S=743 I=37 E=3.28945e-81

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

39

194

S=189 I=30 E=4.37016e-14

Signaling protein ykoW - Bacillus subtilis

Pubmed 11728710,

 

prodomImg

sp

262

671

S=712 I=39 E=1.67537e-77

Uncharacterized signaling protein CC_0091 - Caulobacter crescentus (Caulobacter vibrioides)

 

prodomImg

trembl

1

693

S=2765 I=80 E=0

GGDEF family protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

691

S=2525 I=74 E=0

GGDEF family protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

691

S=2525 I=74 E=0

Putative signal protein with GGDEF and EAL domains - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.30.70.270]

251

428

-

Iprscan IPR001633 [PF00563]

430

671

EAL

Iprscan IPR000160 [PF00990]

256

416

GGDEF

Iprscan IPR005330 [PF03707]

112

173

MHYT

Iprscan IPR005330 [PF03707]

178

234

MHYT

Iprscan IPR005330 [PF03707]

4

44

MHYT

Iprscan IPR005330 [PF03707]

49

110

MHYT

Iprscan IPR001633 [SM00052]

430

676

EAL

Iprscan IPR000160 [SM00267]

249

420

GGDEF

Iprscan IPR000160 [TIGR00254]

256

421

GGDEF

Iprscan IPR001633 [PS50883]

431

685

EAL

Iprscan IPR000160 [PS50887]

290

422

GGDEF

Iprscan IPR005330 [PS50924]

5

195

MHYT

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

102

121

-

Iprscan [tmhmm]

10

29

-

Iprscan [tmhmm]

136

158

-

Iprscan [tmhmm]

170

192

-

Iprscan [tmhmm]

212

234

-

Iprscan [tmhmm]

36

58

-

Iprscan [tmhmm]

73

95

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6PIzONlF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

124 hits
swiss-prot

Swiss-Prot ncbi-blastp

74 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

30 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

21 hits