Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1919rpfCYP_363650.1sensory/regulatory protein RpfC

rpfC XCV1919
XCV1918
XCV1918
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1920
XCV1920
ID rpfC
AC YP_363650.1
LT XCV1919
SY
OR NC_007508 from 2168768 to 2170948 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE sensory/regulatory protein RpfC
IP ATP-binding region, ATPase-like; Signal transduction histidine kinase, homodimeric; CheY-like; Signal transduction histidine kinase, hybrid-type, aerobic respiration control ArcB
CL
EC
GO Biological Process: phosphorylation (GO:0016310)
Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)
Biological Process: signal transduction (GO:0007165)
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Cellular Component: membrane (GO:0016020)
DNA-dependent (GO:0006355)
Molecular Function: two-component response regulator activity (GO:0000156)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
Molecular Function: signal transducer activity (GO:0004871)
transferring phosphorus-containing groups (GO:0016772)
PM
AN
SQ 726 aa
 
........10........20........30........40........50
| | | | |
MKSPLPWLKRRLSGRADSEHAQNLIRIIITTLFISYLGWRYHHTHGDTLM
ATWLILVGELVVSLGLMVAILLRPHVSHTRRLIGMVLDYTCTGAIMAIQG
EPASPLYAVCMWVTIGNGLRYGSPYLRAATAMASLSFLSAILISPYWKAN
PYLSWGLLLGLIAVPLYFDSLLRAMTRAVREARHANQAKSRFLANMSHEF
RTPLNGLSGMTEVLATTRLDAEQKECLNTIQASARSLLSLVEEVLDISAI
EAGKIRIDRRDFSLREMIGSVNMILQPQAKTRGLDYATEVATDVPDLLKG
DTGHLRQVLLNLLGNAVKFTEHGHVLLRVARVSGNGADTMRLRFDVEDSG
IGVPMDMRPRLFEAFEQADVGLSRRYEGTGLGTTIAKGLVEAMGGAIGFA
PNPSGGSVFWFELPLEIGVLETAAPARSPVGALLETPDELEASNVIAFSN
PFLRHRARVRSMRMLVADDHEANRMVLQRLLEKAGHKVACVNGAEQVLDA
MAEEDFDAVIVDLHMPGMSGLDMLKQLRVMQASGMRYTPVVVLSADVTPE
AIRACEQAGARAFLAKPVVAAKLLDTLAELAVSTRALATPATVVQASTSF
EGVLDASVLDELAALGMGEEFERQFVRQCLDDAHNCVGAIERDGTRSDWE
QLRESAHALRGVASNLGLAQLAGSGGELMRMADWQLQAEWRQRLSALRDQ
LQTGKDALAARVQSANDDERSPRSSE
xansp

YP_365524.1 lcl|XCV3793

106

585

S=571 I=32 E=2.70592e-62

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_364899.1 lcl|XCV3168

182

580

S=544 I=37 E=4.96914e-59

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_363946.1 lcl|XCV2215

172

585

S=519 I=35 E=5.60021e-56

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_362259.1 lcl|XCV0528

175

426

S=512 I=44 E=4.1965e-55

two-component system sensor protein

xansp

YP_362259.1 lcl|XCV0528

392

667

S=190 I=26 E=4.8782e-16

two-component system sensor protein

xansp

YP_364402.1 lcl|XCV2671

162

602

S=509 I=33 E=9.86199e-55

two-component system sensor histidine kinase-response regulator hybridprotein

xansp

YP_364402.1 lcl|XCV2671

458

718

S=150 I=29 E=3.28136e-11

two-component system sensor histidine kinase-response regulator hybridprotein

xansp

YP_364897.1 lcl|XCV3166

182

585

S=437 I=33 E=5.41026e-46

two-component system sensor histidine kinase-response regulator hybrid protein

xansp

YP_364896.1 lcl|XCV3165

182

415

S=421 I=40 E=3.9462e-44

two-component system sensor histidine kinase-response regulator hybrid protein

pubmed

1

726

S=3381 I=88 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 11123673

 

prodomImg

pubmed

50

726

S=3220 I=90 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 8810082

 

prodomImg

pubmed

50

726

S=3115 I=88 E=0

Sensory/regulatory protein rpfC EC=2.7.13.3 ; Cell inner membrane Kinase Phosphoprotein Transcription regulation Transferase Transmembrane Two-

Pubmed 1645442

 

prodomImg

pubmed

33

718

S=2026 I=59 E=0

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 17574998

 

prodomImg

pubmed

175

573

S=621 I=37 E=3.00844e-66

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 14660379

 

prodomImg

pubmed

455

579

S=116 I=29 E=4.95186e-05

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 14660379

 

prodomImg

pubmed

189

602

S=585 I=39 E=7.8921e-62

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12855730

 

prodomImg

pubmed

463

620

S=144 I=30 E=2.3454e-08

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12855730

 

prodomImg

pubmed

156

603

S=571 I=32 E=3.72244e-60

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12107144

 

prodomImg

pubmed

453

567

S=147 I=27 E=9.1469e-09

Sensor protein EC=2.7.13.3 ; Kinase Phosphoprotein Transferase

Pubmed 12107144

 

prodomImg

sp

50

726

S=3119 I=88 E=0

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris

 

prodomImg

sp

50

726

S=3115 I=88 E=0

Sensory/regulatory protein rpfC - Xanthomonas campestris pv. campestris (strain 8004)

Pubmed 1645442,

 

prodomImg

sp

175

585

S=532 I=32 E=1.1326e-55

Hybrid signal transduction histidine kinase K - Dictyostelium discoideum (Slime mold)

Pubmed 16473345,16765443,

 

prodomImg

sp

176

411

S=520 I=46 E=3.4545e-54

Hybrid signal transduction histidine kinase J - Dictyostelium discoideum (Slime mold)

 

prodomImg

sp

464

568

S=138 I=28 E=6.44876e-08

Hybrid signal transduction histidine kinase J - Dictyostelium discoideum (Slime mold)

 

prodomImg

trembl

1

726

S=3469 I=90 E=0

Sensor protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

726

S=3469 I=90 E=0

Sensor protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

8

726

S=3432 I=90 E=0

Two component sensor-regulator hybrid protein RpfC - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD000039]

462

577

-

Iprscan IPR004358 [PR00344]

342

356

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

360

370

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

377

395

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

401

414

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

255

417

ATP-binding region, ATPase-like

Iprscan [G3DSA:3.40.50.2300]

455

580

-

Iprscan [PTHR23283]

178

586

-

Iprscan [PTHR23283]

8

586

-

Iprscan [PTHR23283:SF49]

178

586

-

Iprscan [PTHR23283:SF49]

8

586

-

Iprscan IPR001789 [PF00072]

462

578

Signal transduction response regulator, receiver region

Iprscan IPR003661 [PF00512]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR008207 [PF01627]

624

700

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [PF02518]

300

416

ATP-binding region, ATPase-like

Iprscan IPR008207 [SM00073]

614

712

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR003594 [SM00387]

300

417

ATP-binding region, ATPase-like

Iprscan IPR003661 [SM00388]

188

253

Signal transduction histidine kinase, subgroup 1, dimerisation and phosphoacceptor region

Iprscan IPR001789 [SM00448]

462

577

Signal transduction response regulator, receiver region

Iprscan IPR005467 [PS50109]

195

417

Signal transduction histidine kinase, core

Iprscan IPR001789 [PS50110]

463

581

Signal transduction response regulator, receiver region

Iprscan IPR008207 [PS50894]

618

711

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan [SignalP-NN(euk)]

1

39

-

Iprscan [tmhmm]

125

147

-

Iprscan [tmhmm]

152

171

-

Iprscan [tmhmm]

23

40

-

Iprscan [tmhmm]

50

72

-

Iprscan [tmhmm]

93

115

-

Iprscan IPR008207 [SSF47226]

598

716

Signal transduction histidine kinase, phosphotransfer (Hpt) region

Iprscan IPR009082 [SSF47384]

178

249

Signal transduction histidine kinase, homodimeric

Iprscan IPR011006 [SSF52172]

459

581

CheY-like

Iprscan IPR003594 [SSF55874]

242

415

ATP-binding region, ATPase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KPsClh2l)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

64 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

32 hits