Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1851YP_363582.1ISxcc1 transposase

XCV1851
XCV1850
XCV1850
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1852
XCV1852
ID
AC YP_363582.1
LT XCV1851
SY
OR NC_007508 from 2087554 to 2087820 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE ISxcc1 transposase
IP Transposase IS3/IS911
CL
EC
GO DNA-mediated (GO:0006313)
Molecular Function: transposase activity (GO:0004803)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 88 aa
 
........10........20........30........40........50
| | | | |
MRKSKFTDSQIVATLKQVEGGRQVKDVCRELGISDATYYVWKSKYGGMEA
ADVQRLRDLETEHNKLKRMYAELAMENHALKDVIAKKL
xansp

YP_365093.1 lcl|XCV3362

1

88

S=460 I=100 E=3.96813e-50

ISxcc1 transposase

xansp

YP_363578.1 lcl|XCV1847

1

88

S=460 I=100 E=3.96813e-50

ISxcc1 transposase

xansp

YP_362844.1 lcl|XCV1113

1

88

S=460 I=100 E=3.96813e-50

ISxcc1 transposase

xansp

YP_363087.1 lcl|XCV1356

1

88

S=460 I=100 E=3.96813e-50

ISxcc1 transposase

xansp

YP_362869.1 lcl|XCV1138

1

88

S=460 I=100 E=3.96813e-50

ISxcc1 transposase

xansp

YP_361960.1 lcl|XCV0229

1

87

S=259 I=53 E=8.08999e-26

ISxac2 transposase

xansp

YP_363028.1 lcl|XCV1297

1

87

S=259 I=53 E=8.08999e-26

ISxac2 transposase

xansp

YP_361527.1 lcl|XCVc0011

1

87

S=259 I=53 E=8.08999e-26

ISxac2 transposase (fragment)

xansp

YP_365142.1 lcl|XCV3411

1

87

S=254 I=52 E=3.26429e-25

ISxac2 transposase

xansp

YP_362351.1 lcl|XCV0620

1

87

S=254 I=52 E=3.26429e-25

ISxac2 transposase

pubmed

1

88

S=445 I=98 E=3.43403e-46

Transposase

Pubmed 17488332

 

prodomImg

pubmed

1

88

S=327 I=66 E=5.67716e-32

IS1400 transposase A

Pubmed 16902142

 

prodomImg

pubmed

1

88

S=323 I=64 E=1.95801e-31

Transposase OrfA

Pubmed 9435062

 

prodomImg

pubmed

1

88

S=318 I=63 E=8.10989e-31

Transposase 6

Pubmed 17049458

 

prodomImg

pubmed

1

88

S=308 I=64 E=1.08046e-29

IS1400 transposase A

Pubmed 7607411,8955291

 

prodomImg

pubmed

1

88

S=295 I=59 E=4.43259e-28

Low calcium response locus protein S ; Plasmid

Pubmed 1577700

 

prodomImg

pubmed

1

88

S=295 I=59 E=4.43259e-28

Low calcium response locus protein S ; Plasmid

Pubmed 9746557,9748454

 

prodomImg

pubmed

1

87

S=251 I=52 E=9.10174e-23

Transposase ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

88

S=244 I=49 E=7.31306e-22

Putative transposase (Putative IS1617 transposase) ; Plasmid

Pubmed 9748454,9746557

 

prodomImg

pubmed

1

87

S=240 I=49 E=2.2324e-21

Transposase

Pubmed 9375791,10561613

 

prodomImg

sp

1

88

S=295 I=59 E=2.54523e-28

Low calcium response locus protein S - Yersinia pseudotuberculosis

Pubmed 1577700,

 

prodomImg

sp

1

88

S=295 I=59 E=2.54523e-28

Low calcium response locus protein S - Yersinia pestis

Pubmed 9746557,9748454,

 

prodomImg

sp

3

87

S=226 I=46 E=5.54129e-20

Insertion element IS407 uncharacterized 10.0 kDa protein - Burkholderia cepacia (Pseudomonas cepacia)

 

prodomImg

sp

1

87

S=225 I=45 E=7.65088e-20

Insertion element ISR1 uncharacterized 10 kDa protein A3 - Rhizobium sp.

Pubmed 2544911,

 

prodomImg

trembl

1

88

S=456 I=99 E=1.06205e-46

ISxcc1 transposase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

88

S=456 I=99 E=1.06205e-46

ISxcc1 transposase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

trembl

1

88

S=456 I=99 E=1.06205e-46

ISxcc1 transposase ORFA - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

Iprscan IPR002514 [PF01527]

3

80

Transposase IS3/IS911

Iprscan IPR009057 [SSF46689]

1

41

Homeodomain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AZEZlNlN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
trembl

TrEMBL ncbi-blastp

674 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

31 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits