Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1788YP_363519.1AhpC/TSA family peroxiredoxin

XCV1788
XCV1787
XCV1787
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1789
XCV1789
ID
AC YP_363519.1
LT XCV1788
SY
OR NC_007508 from 2010711 to 2011193 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE AhpC/TSA family peroxiredoxin
IP Thioredoxin-like fold
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: antioxidant activity (GO:0016209)
PM
AN
SQ 160 aa
 
........10........20........30........40........50
| | | | |
MTDAVLELPAATFDLPLALSGGTHTTLRDHAGTWLVLYFYPKDSTPGCTT
EGLDFNALLPQFKKAGAMVLGVSRDSVKSHDNFCAKQGFAFPLISDSDEA
LCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGHVVQEWRKVKVAGHAEAV
LAAVKAHAKQ
xansp

YP_362674.1 lcl|ahpC-XCV0943

32

132

S=115 I=38 E=8.58646e-08

Alkyl hydroperoxide reductase subunit C

pubmed

6

141

S=390 I=57 E=4.43098e-39

AHP/TSA peroxiredoxin

Pubmed 18492059

 

prodomImg

pubmed

14

141

S=348 I=52 E=4.26128e-34

Bacterioferritin comigratory protein

Pubmed 12446909

 

prodomImg

pubmed

6

141

S=325 I=46 E=2.94726e-31

Bacterioferritin comigratory protein

Pubmed 11319266

 

prodomImg

pubmed

6

141

S=323 I=46 E=4.88693e-31

Bacterioferritin comigratory protein

Pubmed 11319266

 

prodomImg

pubmed

10

141

S=300 I=45 E=2.96563e-28

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 17088354

 

prodomImg

pubmed

35

132

S=220 I=41 E=1.75827e-18

Bacterioferritin comigratory protein homolog

Pubmed 9293000

 

prodomImg

pubmed

10

134

S=212 I=38 E=1.55494e-17

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 2016588

 

prodomImg

pubmed

9

128

S=204 I=38 E=1.35135e-16

Bcp

Pubmed 12055304

 

prodomImg

pubmed

10

134

S=185 I=34 E=2.50543e-14

Putative peroxiredoxin bcp EC=1.11.1.15 ; Oxidoreductase Peroxidase Redox-active center

Pubmed 9767718

 

prodomImg

pubmed

4

136

S=170 I=35 E=1.63162e-12

Thioredoxin peroxidase

Pubmed 17031636

 

prodomImg

sp

10

141

S=300 I=45 E=1.89315e-28

Putative peroxiredoxin bcp - Coxiella burnetii

Pubmed 17088354,

 

prodomImg

sp

6

132

S=257 I=40 E=3.32273e-23

Putative peroxiredoxin bcp - Helicobacter pylori J99 (Campylobacter pylori J99)

 

prodomImg

sp

6

132

S=254 I=39 E=6.67445e-23

Putative peroxiredoxin bcp - Helicobacter pylori (Campylobacter pylori)

 

prodomImg

sp

10

134

S=212 I=38 E=9.92616e-18

Putative peroxiredoxin bcp - Shigella flexneri

 

prodomImg

sp

10

134

S=212 I=38 E=9.92616e-18

Putative peroxiredoxin bcp - Escherichia coli (strain K12)

Pubmed 2016588,9537378,10644761,

 

prodomImg

trembl

1

141

S=724 I=96 E=8.30793e-79

Bacterioferritin comigratory protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

141

S=722 I=95 E=1.46425e-78

Bacterioferritin comigratory protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

141

S=722 I=95 E=1.46425e-78

Bacterioferritin comigratory protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

4

157

Thioredoxin fold

Iprscan [PTHR10681]

22

156

-

Iprscan [PTHR10681:SF5]

22

156

-

Iprscan IPR000866 [PF00578]

6

137

Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

Iprscan IPR017936 [PS51352]

4

159

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

6

156

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 07EgmpRk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

189 hits
swiss-prot

Swiss-Prot ncbi-blastp

121 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits