Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1559smpAYP_363290.1putative outer membrane protein

smpA XCV1559
XCV1558
XCV1558
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1560
XCV1560
ID smpA
AC YP_363290.1
LT XCV1559
SY
OR NC_007508 from 1757757 to 1758152 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative outer membrane protein
IP SmpA/OmlA
CL
EC
GO Cellular Component: outer membrane (GO:0019867)
PM
AN
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MRNLLLVAAIALSTAGCGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSA
LLGTPSIPDPFHAQRWDYTSTQRVDRLARTEIKNFTVFFENEQVARWEGD
YFPSQDEQLAKAAPKQFGRNLARDKKKQRGR
pubmed

1

131

S=651 I=95 E=5.87831e-71

Outer membrane lipoprotein A

Pubmed 10548726

 

prodomImg

pubmed

21

110

S=174 I=38 E=3.75006e-13

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

21

105

S=171 I=40 E=8.00689e-13

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

12

109

S=167 I=35 E=2.76151e-12

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

pubmed

20

109

S=154 I=37 E=1.06584e-10

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

sp_Pdown

O68564|OMLA_PSEFL

12

109

S=167 I=35 E=1.78637e-12

Outer membrane lipoprotein omlA precursor - Pseudomonas fluorescens

sp_Pdown

O68562|OMLA_PSEAE

20

109

S=154 I=37 E=6.89472e-11

Outer membrane lipoprotein omlA precursor - Pseudomonas aeruginosa

sp_Pdown

P44057|SMPA_HAEIN

1

90

S=140 I=36 E=3.30921e-09

Small protein A homolog precursor - Haemophilus influenzae

sp_Pdown

P0A939|SMPA_SHIFL

8

94

S=134 I=34 E=1.85974e-08

Small protein A precursor - Shigella flexneri

sp_Pdown

P0A937|SMPA_ECOLI

8

94

S=134 I=34 E=1.85974e-08

Small protein A precursor - Escherichia coli (strain K12)

trembl_Pdown

Q8PMB6|Q8PMB6_XANAC

1

131

S=689 I=98 E=9.46931e-75

Outer membrane protein - Xanthomonas axonopodis pv. citri

trembl_Pdown

Q5H191|Q5H191_XANOR

1

131

S=675 I=95 E=4.87325e-73

Outer membrane protein - Xanthomonas oryzae pv. oryzae

trembl_Pdown

Q2P464|Q2P464_XANOM

1

131

S=675 I=95 E=4.87325e-73

Outer membrane protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

Iprscan IPR007450 [PF04355]

17

99

SmpA/OmlA

Iprscan [PS51257]

1

17

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [tmhmm]

4

21

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pq6yQy7F)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
trembl

TrEMBL ncbi-blastp

268 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits