Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1495brfYP_363226.1bacterioferritin

brf XCV1495
XCV1494
XCV1494
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1496
XCV1496
ID brf
AC YP_363226.1
LT XCV1495
SY
OR NC_007508 from 1684664 to 1685149 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE bacterioferritin
IP Ferritin and Dps; Ferritin/ribonucleotide reductase-like
CL
EC
GO Biological Process: cellular iron ion homeostasis (GO:0006879)
Biological Process: iron ion transport (GO:0006826)
Molecular Function: transition metal ion binding (GO:0046914)
Molecular Function: ferric iron binding (GO:0008199)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 161 aa
 
........10........20........30........40........50
| | | | |
MKGHPEVVDYLKQLLRGELAARDQYFLHSRRYEDQGLMALYERINHEMEE
ETEHADALLRRILFLEGDPDMRPAEFTPGKTVVEMLERDLVVEYEVRAAL
AAGMKLCEEHGDYVSRDVLLKQLQDTEEDHAWWLEQQLGLIKRIGLELYQ
TSKIDKGHVAG
xansp

YP_362258.1 lcl|bfr-XCV0527

1

155

S=256 I=41 E=6.20965e-25

bacterioferritin

pubmed

1

154

S=576 I=69 E=1.21644e-61

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 15345421

 

prodomImg

pubmed

1

154

S=556 I=68 E=3.3976e-59

Putative bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 11728709

 

prodomImg

pubmed

1

154

S=538 I=67 E=4.52274e-57

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 9358059

 

prodomImg

pubmed

1

154

S=446 I=60 E=5.9754e-46

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1536655

 

prodomImg

pubmed

1

152

S=331 I=50 E=5.13695e-32

Bacterioferritin subunit 1 ; Heme Iron storage Metal-binding

Pubmed 9409768

 

prodomImg

pubmed

30

152

S=320 I=56 E=1.08638e-30

Bacterioferritin alpha subunit ; Heme Iron storage Metal-binding

Pubmed 11250081

 

prodomImg

pubmed

1

156

S=305 I=46 E=8.34952e-29

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 1549605,1904771

 

prodomImg

pubmed

1

73

S=302 I=78 E=2.06756e-28

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 10368148

 

prodomImg

pubmed

1

154

S=273 I=41 E=5.77002e-25

Bacterioferritin ; Heme Iron storage Metal-binding

Pubmed 2661540

 

prodomImg

pubmed

1

156

S=263 I=40 E=1.08951e-23

Bacterioferritin ; Cytoplasm Heme Iron storage Membrane Metal-binding

Pubmed 8006590

 

prodomImg

sp

1

154

S=566 I=71 E=1.06155e-60

Bacterioferritin - Pseudomonas aeruginosa

 

prodomImg

sp

1

154

S=538 I=67 E=2.88602e-57

Bacterioferritin - Pseudomonas putida

Pubmed 9358059,

 

prodomImg

sp

1

154

S=455 I=60 E=3.62167e-47

Bacterioferritin A - Neisseria meningitidis serogroup A

 

prodomImg

sp

1

154

S=452 I=59 E=7.80047e-47

Bacterioferritin A - Neisseria meningitidis serogroup B

 

prodomImg

sp

1

154

S=452 I=59 E=7.80047e-47

Bacterioferritin A - Neisseria gonorrhoeae

 

prodomImg

trembl

1

161

S=835 I=100 E=3.44818e-92

Bacterioferritin - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

161

S=822 I=98 E=1.14753e-90

Bacterioferritin - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

161

S=822 I=98 E=1.14753e-90

Bacterioferritin - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [PD002269]

6

69

-

Iprscan [coil]

41

62

-

Iprscan IPR002024 [PR00601]

106

126

Bacterioferritin

Iprscan IPR002024 [PR00601]

128

149

Bacterioferritin

Iprscan IPR002024 [PR00601]

23

43

Bacterioferritin

Iprscan IPR002024 [PR00601]

3

22

Bacterioferritin

Iprscan IPR002024 [PR00601]

44

64

Bacterioferritin

Iprscan IPR002024 [PR00601]

85

105

Bacterioferritin

Iprscan IPR012347 [G3DSA:1.20.1260.10]

1

161

Ferritin-related

Iprscan IPR002024 [PIRSF002560]

1

158

Bacterioferritin

Iprscan IPR008331 [PF00210]

8

144

Ferritin and Dps

Iprscan IPR002024 [TIGR00754]

1

157

Bacterioferritin

Iprscan IPR002024 [PS00549]

1

19

Bacterioferritin

Iprscan IPR009040 [PS50905]

1

145

Ferritin-like

Iprscan IPR009078 [SSF47240]

1

156

Ferritin/ribonucleotide reductase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OC8MVQ36)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

23 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
trembl

TrEMBL ncbi-blastp

492 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits