Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1294YP_363025.1IS1479 transposase

XCV1294
IS_1479_3
IS_1479_3
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1295
XCV1295
ID
AC YP_363025.1
LT XCV1294
SY
OR NC_007508 from 1452185 to 1453165 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE IS1479 transposase
IP Transposase, IS4-like
CL
EC
GO DNA-mediated (GO:0006313)
Molecular Function: transposase activity (GO:0004803)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 326 aa
 
........10........20........30........40........50
| | | | |
MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLVAPHYPVSGRPG
RQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPD
ETTILNFRRLLETHGLAARMLEAVNAHLARKGQSLRSGTIVDATLIAAPS
STKNADHARDPEMHQTKKGNQWYFGMKAHIGVDEFSGLVHHVHCTAANVA
DVTVTHALLHGKEDSVFGDSGYTGADNREELQTCKAAFFIAARRSVLQAI
GNKRERAREQRWEHFKASVRAKVEHPFRVIKRQFGYTKVRYRGLAKNTAQ
VLTLFALSNLWMKRKQLLPAMGSVRL
xansp

YP_365126.1 lcl|XCV3395

1

326

S=1745 I=100 E=0

IS1479 transposase

xansp

YP_361860.1 lcl|XCV0129

1

326

S=1745 I=100 E=0

IS1479 transposase

xansp

YP_365907.1 lcl|XCV4176

1

326

S=1745 I=100 E=0

IS1479 transposase

xansp

YP_362353.1 lcl|XCV0622

1

326

S=1745 I=100 E=0

IS1479 transposase

xansp

YP_361585.1 lcl|XCVd0026

1

326

S=1745 I=100 E=0

IS1479 transposase

xansp

YP_361580.1 lcl|XCVd0021

1

326

S=1745 I=100 E=0

IS1646 transposase

xansp

YP_364445.1 lcl|XCV2714

260

309

S=205 I=76 E=2.681e-18

putative transposase (fragment)

xansp

YP_364443.1 lcl|XCV2712

21

87

S=171 I=45 E=3.85371e-14

putative transposase (fragment)

xansp

YP_364444.1 lcl|XCV2713

153

224

S=145 I=45 E=4.90696e-11

putative transposase (fragment)

pubmed

1

322

S=1594 I=91 E=0

Putative transposase

Pubmed 10940020

 

prodomImg

pubmed

2

325

S=1072 I=65 E=2.67252e-121

IS2000 transposase (Transposase)

Pubmed 10427724,10049269

 

prodomImg

pubmed

2

326

S=1049 I=63 E=1.5258e-118

DDE-type transposase

Pubmed 18487340

 

prodomImg

pubmed

2

326

S=1049 I=63 E=1.91402e-118

DDE-type transposase

Pubmed 15941993

 

prodomImg

pubmed

2

326

S=1048 I=63 E=2.14373e-118

Transposase ; Plasmid

Pubmed 12547188,15466034

 

prodomImg

pubmed

2

326

S=1047 I=63 E=3.28632e-118

Transposase ; Plasmid

Pubmed 11371531,9244273

 

prodomImg

pubmed

2

326

S=1047 I=63 E=3.28632e-118

Transposase ; Plasmid

Pubmed 12177326,15288784

 

prodomImg

pubmed

2

326

S=1042 I=63 E=1.18393e-117

Transposase-like protein TnpA3

Pubmed 9765796,11133479

 

prodomImg

pubmed

2

326

S=1041 I=63 E=1.53787e-117

Transposase like protein TnpA1

Pubmed 10433976

 

prodomImg

pubmed

2

326

S=1040 I=63 E=1.91242e-117

Transposase

Pubmed 11371531,9244273

 

prodomImg

sp

2

311

S=876 I=54 E=1.03958e-97

Transposase insH for insertion sequence element IS5Y - Escherichia coli (strain K12)

 

prodomImg

sp

2

311

S=868 I=54 E=9.19358e-97

Transposase insH for insertion sequence element IS5 - Escherichia coli (strain K12)

Pubmed 6269959,6269958,8041620,

 

prodomImg

sp

104

300

S=139 I=28 E=2.28794e-08

Transposase for insertion sequence element IS1106 - Neisseria meningitidis serogroup B

Pubmed 1320728,

 

prodomImg

trembl

1

326

S=1738 I=100 E=0

Putative transposase - Xanthomonas euvesicatoria

 

prodomImg

trembl

1

326

S=1732 I=99 E=0

IS1479 transposase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

326

S=1732 I=99 E=0

IS1479 transposase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR002559 [PF01609]

138

312

Transposase, IS4-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LBKxXNOH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

71 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
trembl

TrEMBL ncbi-blastp

578 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits