Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1162YP_362893.1putative inosine-uridine preferring nucleoside hydrolase

XCV1162
XCV1161
XCV1161
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1163
XCV1163
ID
AC YP_362893.1
LT XCV1162
SY
OR NC_007508 from 1294327 to 1295298 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative inosine-uridine preferring nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL
EC
GO
PM
AN
SQ 323 aa
 
........10........20........30........40........50
| | | | |
MAMWCVATTAGAQQSAAAVQSTLASVQAEKVVVSTDVGDDIDDAFALGLL
LRRPQLQVLGIASAWGDTALRAQLLQRLLQQAGRSEIPLAAGARTTSTIA
FSQARWAAKGQLPAALPDAAAMILQQARQHPGEVTLMVLGPMTDAALAQQ
RDPAGFAKLKRVVAMGGSVRVGYGKSAYRPASAPAPEYNILADVPAAQRV
FSSGVPIVLLPLDATQITLEEPERIALFAHGDGLTDALTQLYYQWRNTDQ
PWASATPTLFDVVPVAWLLRPALCPTTPLHLDVDAQGYTREGAGAPNVQA
CLHVDKPALIEMYMRALLELHGE
xansp

YP_362047.1 lcl|XCV0316

113

220

S=131 I=39 E=2.13322e-09

putative nucleoside hydrolase

xansp

YP_365238.1 lcl|iunH-XCV3507

31

206

S=99 I=29 E=2.08936e-05

inosine-uridine preferring nucleoside hydrolase

pubmed

131

314

S=192 I=30 E=1.05365e-14

Non-specific ribonucleoside hydrolase rihC EC=3.2.-.- ; Glycosidase

Pubmed 2011499,1630901

 

prodomImg

pubmed

30

303

S=160 I=27 E=8.82092e-11

Inosine-uridine nucleoside N-ribohydrolase

Pubmed 17449683

 

prodomImg

pubmed

30

323

S=150 I=26 E=1.43614e-09

Putative inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16204499

 

prodomImg

pubmed

30

300

S=143 I=25 E=1.13396e-08

Nucleoside hydrolase

Pubmed 16707707

 

prodomImg

pubmed

30

292

S=135 I=24 E=9.43448e-08

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

30

292

S=133 I=24 E=1.55078e-07

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

30

292

S=132 I=24 E=2.19791e-07

Nonspecific nucleoside hydrolase (Inosine-uridine preferring nucleoside hydrolase) (Nucleoside hydrolase) EC=3.2.2.1 ; Glycosidase

Pubmed 11738828,16725143

 

prodomImg

pubmed

30

292

S=132 I=24 E=2.19791e-07

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

30

292

S=131 I=24 E=3.36936e-07

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

pubmed

30

292

S=131 I=24 E=3.36936e-07

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16725143

 

prodomImg

sp

42

292

S=229 I=30 E=2.38075e-19

Pyrimidine-specific ribonucleoside hydrolase rihA - Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

 

prodomImg

sp

42

292

S=224 I=29 E=9.19648e-19

Pyrimidine-specific ribonucleoside hydrolase rihA - Escherichia coli O6

 

prodomImg

sp

42

292

S=224 I=29 E=9.19648e-19

Pyrimidine-specific ribonucleoside hydrolase rihA - Escherichia coli O1:K1 / APEC

 

prodomImg

sp

42

292

S=222 I=29 E=1.96358e-18

Pyrimidine-specific ribonucleoside hydrolase rihA - Shigella boydii serotype 4 (strain Sb227)

 

prodomImg

sp

42

292

S=221 I=29 E=2.16122e-18

Pyrimidine-specific ribonucleoside hydrolase rihA - Shigella sonnei (strain Ss046)

 

prodomImg

trembl

29

320

S=1376 I=91 E=3.34693e-157

Inosine-uridine preferring nucleoside hydrolase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

321

S=1371 I=83 E=1.23772e-156

Inosine-uridine preferring nucleoside hydrolase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

321

S=1360 I=83 E=2.52786e-155

Inosine-uridine preferring nucleoside hydrolase - Xanthomonas oryzae pv. oryzae

 

prodomImg

Iprscan [PD007736]

42

292

-

Iprscan IPR001910 [G3DSA:3.90.245.10]

28

317

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

23

321

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

30

317

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [SSF53590]

28

323

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hv0W4wiX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

66 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits