Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1102opsXYP_362833.1lipopolysaccharide core biosynthesis heptosyltransferase

opsX XCV1102
XCV1101
XCV1101
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1103
XCV1103
ID opsX
AC YP_362833.1
LT XCV1102
SY
OR NC_007508 from 1236339 to 1237181 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE lipopolysaccharide core biosynthesis heptosyltransferase
IP Glycosyl transferase, family 9
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: transferase activity (GO:0016740)
PM
AN
SQ 280 aa
 
........10........20........30........40........50
| | | | |
MRALRRSLAPLGRFDALLQMQVAFRANVLSAFVPARRRIGYDRSRSKDLH
GLFVNERIADRPGIHVLDAIGSFAEPLGLRQTQVRWDLPVPDQAHAWARA
QWDDDGRPVLMISPCSSHPRRNWYPDRLAALADHAAAQGWRIVLCGGRSD
LERSTADAIVAAARTPVLDLVGKDTLKQLPALLARADLVVTPDSGPMHIA
NAMGTKVLGLHAASNPRRSGPYSDVRYCVDRYDAAARKFLHKPADQLRWG
TKIEFDEVMSLITVDDAIAAFERYRADHPR
pubmed

1

280

S=1292 I=90 E=5.66496e-148

DNA, complete cds

Pubmed 8376331

 

prodomImg

pubmed

13

277

S=466 I=37 E=5.63648e-48

WaaC

Pubmed 18310345

 

prodomImg

pubmed

33

273

S=419 I=34 E=3.38232e-42

Lipopolysaccharide biosynthesis protein

Pubmed 17185550

 

prodomImg

pubmed

33

181

S=221 I=32 E=2.78471e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=221 I=31 E=2.98588e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=221 I=31 E=2.98588e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=221 I=31 E=2.98588e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=221 I=31 E=3.09185e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=221 I=31 E=3.43286e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

pubmed

33

181

S=219 I=32 E=5.17157e-18

Heptosyl transferase

Pubmed 12797973

 

prodomImg

sp

13

273

S=473 I=36 E=5.31276e-49

Putative glycosyltransferase HI0261 - Haemophilus influenzae

 

prodomImg

sp

12

215

S=145 I=25 E=2.91535e-09

Lipopolysaccharide core biosynthesis glycosyltransferase rfaQ - Escherichia coli (strain K12)

Pubmed 1732225,1447141,8041620,

 

prodomImg

sp

107

224

S=122 I=28 E=1.84801e-06

ADP-heptose--LPS heptosyltransferase 2 - Haemophilus influenzae

 

prodomImg

sp

13

223

S=111 I=24 E=4.41562e-05

ADP-heptose--LPS heptosyltransferase 2 - Escherichia coli (strain K12)

Pubmed 8041620,2198271,8478319,

 

prodomImg

trembl

1

280

S=1352 I=94 E=1.82503e-154

Saccharide biosynthesis regulatory protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

280

S=1348 I=93 E=5.38019e-154

Saccharide biosynthesis regulatory protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

280

S=1347 I=93 E=7.42845e-154

Heptosyl transferase, glycosyltransferase family 9 protein - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [G3DSA:3.40.50.2000]

90

272

-

Iprscan IPR002201 [PF01075]

1

250

Glycosyl transferase, family 9

Iprscan [SSF53756]

1

273

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rc6iBVSZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
trembl

TrEMBL ncbi-blastp

519 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits