Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1041YP_362772.1putative oxidoreductase

XCV1041
XCV1040
XCV1040
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1042
XCV1042
ID
AC YP_362772.1
LT XCV1041
SY
OR NC_007508 from 1167822 to 1168457 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 211 aa
 
........10........20........30........40........50
| | | | |
MKAVALTRHLPIDDPESLLDMELPTPAAPSGYDLLVRVEAISVNPVDTKV
RAPTPQPLHAPKILGYDAAGVIEAVGPEVTAFAVGDEVYYAGDIGRPGSN
AQYQLVDARIAGCKPTSLSFAQAAALPLTTLTAWELLFQRMPFSFDGARN
RGRHLLIIGGAGGVGSIAIQLARHAGFTVIATASRPESIEWVRQMGAHHV
IDHHQPLQPQL
xansp

YP_366191.1 lcl|XCV4460

1

207

S=393 I=46 E=2.53356e-41

putative oxidoreductase

xansp

YP_364778.1 lcl|XCV3047

17

88

S=110 I=44 E=4.41669e-07

putative alcohol dehydrogenase

xansp

YP_362575.1 lcl|XCV0844

14

202

S=93 I=28 E=5.34164e-05

putative quinone oxidoreductase

pubmed

1

211

S=439 I=46 E=8.21723e-45

Putative zinc-binding dehydrogenase

Pubmed 15574953

 

prodomImg

pubmed

1

211

S=331 I=36 E=9.26421e-32

Zinc-type alcohol dehydrogenase-like protein SA1988 ; Metal-binding Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

22

205

S=191 I=30 E=8.01392e-15

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

29

200

S=185 I=37 E=4.1277e-14

Glycosyl hydrolase

Pubmed 17086451

 

prodomImg

pubmed

8

205

S=171 I=31 E=2.03365e-12

Zeta-crystallin ; Cytoplasm DNA-binding

Pubmed 9154917

 

prodomImg

pubmed

13

204

S=167 I=28 E=6.20796e-12

Enoyl reductase

Pubmed 12172803,12242508

 

prodomImg

pubmed

1

205

S=161 I=28 E=3.45852e-11

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

15

208

S=161 I=30 E=3.67617e-11

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP

Pubmed 7476124

 

prodomImg

pubmed

8

206

S=160 I=25 E=4.65191e-11

DTDP-glucose 4,6-dehydratase

Pubmed 17074846

 

prodomImg

pubmed

8

203

S=159 I=30 E=5.88663e-11

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

sp

1

211

S=338 I=35 E=9.34908e-33

Zinc-type alcohol dehydrogenase-like protein SERP1785 - Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

 

prodomImg

sp

1

211

S=337 I=36 E=1.02901e-32

Zinc-type alcohol dehydrogenase-like protein MW2112 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

1

211

S=337 I=36 E=1.02901e-32

Zinc-type alcohol dehydrogenase-like protein SAS2087 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

sp

1

211

S=337 I=36 E=1.13259e-32

Zinc-type alcohol dehydrogenase-like protein SACOL2177 - Staphylococcus aureus (strain COL)

 

prodomImg

sp

1

211

S=334 I=34 E=2.63853e-32

Zinc-type alcohol dehydrogenase-like protein SE_1777 - Staphylococcus epidermidis (strain ATCC 12228)

 

prodomImg

trembl

1

211

S=902 I=83 E=4.31536e-100

Oxidoreductase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

211

S=902 I=83 E=4.79132e-100

Oxidoreductase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

211

S=902 I=83 E=4.79132e-100

Oxidoreductase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan [G3DSA:3.90.180.10]

1

158

-

Iprscan IPR002085 [PTHR11695]

18

203

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF34]

18

203

-

Iprscan IPR013149 [PF00107]

151

204

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

31

109

Alcohol dehydrogenase GroES-like

Iprscan IPR014182 [TIGR02817]

2

211

Alcohol dehydrogenase, zinc-binding type 1

Iprscan IPR011032 [SSF50129]

1

141

GroES-like

Iprscan IPR016040 [SSF51735]

122

206

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one JvUXV6SG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits