Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV1034mdhYP_362765.1malate dehydrogenase

mdh XCV1034
XCV1033
XCV1033
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV1035
XCV1035
ID mdh
AC YP_362765.1
LT XCV1034
SY
OR NC_007508 from 1161285 to 1162271 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE malate dehydrogenase
IP Lactate/malate dehydrogenase
CL
EC
GO Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: metabolic process (GO:0008152)
Biological Process: glycolysis (GO:0006096)
Biological Process: cellular carbohydrate metabolic process (GO:0044262)
Biological Process: malate metabolic process (GO:0006108)
Molecular Function: malate dehydrogenase activity (GO:0016615)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
NAD or NADP as acceptor (GO:0016616)
PM
AN
SQ 328 aa
 
........10........20........30........40........50
| | | | |
MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPIEKAQA
ALKGVMMELEDCAFPLLAGMVGTDDAEVAFKDVDIALLVGSRPRGPGMER
KDLLLANAEIFTAQGAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLD
PKNFTAMLRLDHNRALSQLSAKLGKPVAGIEKLAVWGNHSPTMYPDYRFA
TADGASVGDAINDQEWNASTFIPTVGKRGAAIIEARGLSSAASAANAAID
HIRDWVLGTNGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGKYTIVKDLP
IDDFSQKYIDKTLAELEEERSGVAHLLG
Hamap MDH_MF_01517 raw_score=11190 norm_score=55.608

Malate dehydrogenase [mdh].

pubmed

1

327

S=1340 I=78 E=1.05193e-153

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17344419

 

prodomImg

pubmed

2

328

S=1289 I=74 E=1.47056e-147

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 10206992

 

prodomImg

pubmed

6

327

S=1285 I=77 E=4.94091e-147

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 9190829

 

prodomImg

pubmed

2

328

S=1272 I=75 E=1.80981e-145

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12113928,16133321

 

prodomImg

pubmed

2

327

S=1220 I=70 E=3.64892e-139

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 8900056

 

prodomImg

pubmed

1

326

S=1027 I=62 E=8.63495e-116

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 3771528,2034208

 

prodomImg

pubmed

1

326

S=932 I=57 E=2.87471e-104

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17194220

 

prodomImg

pubmed

2

326

S=928 I=58 E=7.11854e-104

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 17369815

 

prodomImg

pubmed

1

320

S=853 I=52 E=1.13135e-94

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 12612830

 

prodomImg

pubmed

1

328

S=842 I=50 E=1.85809e-93

Malate dehydrogenase, cytoplasmic EC=1.1.1.37 ; Acetylation NAD Oxidoreductase Phosphoprotein Tricarboxylic acid cycle

Pubmed 8682322,3312200

 

prodomImg

sp

1

328

S=1649 I=96 E=0

Malate dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

sp

1

328

S=1582 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris

 

prodomImg

sp

1

328

S=1582 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

sp

1

328

S=1573 I=90 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae

 

prodomImg

sp

1

328

S=1573 I=90 E=0

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

328

S=1578 I=91 E=0

Malate dehydrogenase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

1

328

S=1571 I=90 E=0

Malate dehydrogenase - Stenotrophomonas maltophilia R551-3

 

prodomImg

trembl

1

328

S=1569 I=90 E=1.31473e-180

Malate dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan [PD003052]

261

320

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

156

NAD(P)-binding

Iprscan IPR015955 [G3DSA:3.90.110.10]

157

326

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Iprscan IPR001557 [PIRSF000102]

4

322

L-lactate/malate dehydrogenase

Iprscan IPR010945 [PTHR23382]

99

327

Malate dehydrogenase, NAD or NADP

Iprscan IPR001236 [PF00056]

5

156

Lactate/malate dehydrogenase

Iprscan IPR001236 [PF02866]

159

327

Lactate/malate dehydrogenase

Iprscan IPR010945 [TIGR01759]

2

323

Malate dehydrogenase, NAD or NADP

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan IPR016040 [SSF51735]

2

157

NAD(P)-binding

Iprscan IPR015955 [SSF56327]

158

328

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one oYfYQ0gr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

124 hits
swiss-prot

Swiss-Prot ncbi-blastp

280 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

11 hits