Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0946YP_362677.1putative N-formylglutamate amidohydrolase

XCV0946
XCV0945
XCV0945
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0947
XCV0947
ID
AC YP_362677.1
LT XCV0946
SY
OR NC_007508 from 1074579 to 1075364 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative N-formylglutamate amidohydrolase
IP N-formylglutamate amidohydrolase
CL
EC
GO
PM
AN
SQ 261 aa
 
........10........20........30........40........50
| | | | |
MADAAIEPLLGADDPAPFTVHNAQAASPWLLIADHAGQRVPARLADLGLP
QVELDRHIGWDIGIAQVTQRLAEALDALAIAQTYSRLVIDCNRPHDAPSL
MPAVSDGTLVPGNQHLTDSDRQQRIAAIFAPYHARIAAELDARAQRNQPT
ILVSMHSFTPVMAGNARPWHAGVLYHRDTRLAHRLLQALRAEPDLVVGDN
QPYAVSDATDYAIPVYGEGRGLLHVELEIRQDLIADAAGQQAWAARLARI
LPPLADALLAR
pubmed

20

234

S=321 I=33 E=1.91342e-30

Riorf59 protein ; Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

28

234

S=315 I=37 E=1.04756e-29

Orf3; putative

Pubmed 9244287

 

prodomImg

pubmed

30

234

S=249 I=29 E=1.22806e-21

Putative uncharacterized protein ipuJ

Pubmed 11976110

 

prodomImg

trembl

1

234

S=1044 I=87 E=3.74546e-117

N-formylglutamate amidohydrolase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

234

S=1040 I=86 E=1.25843e-116

Putative uncharacterized protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

234

S=1040 I=86 E=1.25843e-116

Putative uncharacterized protein XOO3440 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR011227 [PIRSF029730]

1

258

Uncharacterized conserved protein UCP029730

Iprscan IPR007709 [PF05013]

26

236

N-formylglutamate amidohydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IiM6KxRf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

181 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits