Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0943ahpCYP_362674.1Alkyl hydroperoxide reductase subunit C

ahpC XCV0943
XCV0942
XCV0942
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0944
XCV0944
ID ahpC
AC YP_362674.1
LT XCV0943
SY
OR NC_007508 from 1071568 to 1072131 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE Alkyl hydroperoxide reductase subunit C
IP Thioredoxin-like fold; Peroxiredoxin
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: antioxidant activity (GO:0016209)
PM
AN
SQ 187 aa
 
........10........20........30........40........50
| | | | |
MSLINTQVQPFKANAYHNGNFIEVTEASLKGKWSVLIFMPAAFTFNCPTE
VEDAADNYAAFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDP
THKLTRAFGVHIEEEGLALRGTFIINPEGVIKTLEIHDNSIARDVTETLR
KLTAAQFVANNPGQVCPAKWKEGAKTLAPSLDLVGKI
xansp

YP_363519.1 lcl|XCV1788

31

129

S=114 I=38 E=1.28587e-07

AhpC/TSA family peroxiredoxin

pubmed

1

187

S=994 I=100 E=2.99127e-112

Alkyl hydroperoxide reductase subunit C

Pubmed 9190810

 

prodomImg

pubmed

1

187

S=660 I=61 E=9.22474e-72

Peroxiredoxin

Pubmed 10862622

 

prodomImg

pubmed

1

187

S=629 I=60 E=5.59336e-68

Strongly similar to alkyl hydroperoxide reductase

Pubmed 16563686

 

prodomImg

pubmed

1

187

S=625 I=59 E=1.84682e-67

Alkyl hydroperoxide reductase C

Pubmed 10960086

 

prodomImg

pubmed

1

187

S=615 I=57 E=2.75575e-66

Alkyl hydroperoxide reductase subunit C EC=1.11.1.15 ; Antioxidant Oxidoreductase Peroxidase Redox-active center

Pubmed 1592833

 

prodomImg

pubmed

1

187

S=613 I=58 E=4.6094e-66

Alkyl hydroperoxide reductase subunit C EC=1.11.1.15 ; Antioxidant Oxidoreductase Peroxidase Redox-active center

Pubmed 2191951,8041738

 

prodomImg

pubmed

1

187

S=593 I=57 E=1.40473e-63

Alkyl hydroperoxide reductase subunit C EC=1.11.1.15 ; Antioxidant Oxidoreductase Peroxidase Redox-active center Stress response

Pubmed 8180695

 

prodomImg

pubmed

3

187

S=593 I=56 E=1.49313e-63

Alkyl hydroperoxide reductase subunit C

Pubmed 10482511

 

prodomImg

pubmed

1

187

S=560 I=52 E=1.20717e-59

Alkyl hydroperoxidase (Alkyl hydroperoxide reductase)

Pubmed 7765479,10656297

 

prodomImg

pubmed

1

187

S=556 I=53 E=3.49723e-59

Alkyl hydroperoxide reductase subunit C

Pubmed 17636987

 

prodomImg

sp

1

187

S=615 I=57 E=1.77451e-66

Alkyl hydroperoxide reductase subunit C - Shigella flexneri

 

prodomImg

sp

1

187

S=615 I=57 E=1.77451e-66

Alkyl hydroperoxide reductase subunit C - Escherichia coli (strain K12)

Pubmed 1592833,1575737,7499381,8774726,9600841,

 

prodomImg

sp

1

187

S=615 I=57 E=1.77451e-66

Alkyl hydroperoxide reductase subunit C - Escherichia coli O6

 

prodomImg

sp

1

187

S=615 I=57 E=1.77451e-66

Alkyl hydroperoxide reductase subunit C - Escherichia coli O157:H7

 

prodomImg

sp

1

187

S=613 I=58 E=2.96813e-66

Alkyl hydroperoxide reductase subunit C - Salmonella typhimurium

Pubmed 2191951,8041738,2643600,2693740,11969410,12714747,16060667,

 

prodomImg

trembl

1

187

S=994 I=100 E=2.09481e-111

Alkyl hydroperoxide reductase subunit C - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

187

S=994 I=100 E=2.09481e-111

Alkyl hydroperoxide reductase subunit C - Xanthomonas campestris

Pubmed 9190810,

 

prodomImg

trembl

1

187

S=990 I=99 E=6.73808e-111

Alkyl hydroperoxide reductase subunit C - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

2

187

Thioredoxin fold

Iprscan [PTHR10681]

1

180

-

Iprscan [PTHR10681:SF7]

1

180

-

Iprscan IPR000866 [PF00578]

4

134

Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen

Iprscan IPR017559 [TIGR03137]

1

187

Peroxiredoxin

Iprscan IPR017936 [PS51352]

2

157

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

2

187

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zhito4Ho)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

223 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits