Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0917YP_362648.1putative aldehyde dehydrogenase

XCV0917
XCV0916
XCV0916
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0918
XCV0918
ID
AC YP_362648.1
LT XCV0917
SY
OR NC_007508 from 1046781 to 1048250 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative aldehyde dehydrogenase
IP Aldehyde/histidinol dehydrogenase
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
PM
AN
SQ 489 aa
 
........10........20........30........40........50
| | | | |
MEALFETLRGIAARGPLGLFIDGQWRASTGDRSVDVIAPHTEERLLRYTE
PSHADTEAAIAAARRAFDHGPWPQLSPQARSVALKRVADHLRARMPELAE
AWTGQVGATLGFSKRASQQAPDLFDYYADLIATHAFVEPRVRPNGGRVHV
VQEPVGVVAAITPWNAPLVLLCYKVAAALAAGCTVVAKPSPETPIDAYIL
AECISAAGVPDGVFNLLPAGREVGEQLIRHPHVDKVSFTGSTQAGRSIGI
ACAERLARVGLELGGKSAAIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRREEVLQAYCAALSAVKLGDPFAEDTGMGPLALGRQLERVQSY
IAKGKAQGARLAMGGGRPAHLSRGFFVEPTVFAEVTPDMTIAREEIFGPV
VSFIDYHDEADLIAKAKASDYGLHGTIYSEDAERAYRIARRVRSGSHAIN
GMWVDISMPFGGFKHSGIGREGGIEGLHAFLETKTLYLS
xansp

YP_362506.1 lcl|betB-XCV0775

19

488

S=673 I=36 E=7.36008e-75

betaine aldehyde dehydrogenase

xansp

YP_361836.1 lcl|XCV0105

20

489

S=541 I=33 E=8.57084e-59

putative aldehyde dehydrogenase

xansp

YP_364378.1 lcl|XCV2647

72

489

S=518 I=30 E=4.56359e-56

putative aldehyde dehydrogenase

xansp

YP_362098.1 lcl|XCV0367

77

473

S=415 I=30 E=1.74527e-43

putative aldehyde dehydrogenase

xansp

YP_363094.1 lcl|XCV1363

19

486

S=391 I=28 E=1.41221e-40

putative aldehyde dehydrogenase

xansp

YP_365739.1 lcl|putA-XCV4008

72

485

S=344 I=30 E=5.92733e-35

bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

xansp

YP_363569.1 lcl|XCV1838

22

485

S=344 I=26 E=6.41117e-35

putative aldehyde dehydrogenase

xansp

YP_366076.1 lcl|XCV4345

72

480

S=282 I=30 E=1.87899e-27

putative aldehyde dehydrogenase

pubmed

19

488

S=872 I=42 E=7.78235e-97

Hypothetical aldehyde dehydrogenase ; Plasmid

Pubmed 9025284,10217489

 

prodomImg

pubmed

19

486

S=810 I=42 E=2.98868e-89

6-oxolauric acid dehydrogenase

Pubmed 11591693

 

prodomImg

pubmed

19

486

S=757 I=37 E=6.80804e-83

Predicted NAD-dependent aldehyde dehydrogenase

Pubmed 16008504

 

prodomImg

pubmed

20

486

S=749 I=39 E=6.56921e-82

NAD-dependent aldehyde dehydrogenase

Pubmed 17894863

 

prodomImg

pubmed

20

486

S=747 I=39 E=1.11812e-81

P-cumic aldehyde dehydrogenase ; Oxidoreductase

Pubmed 8631713,9150211

 

prodomImg

pubmed

20

486

S=743 I=37 E=3.56529e-81

Putative aldehyde dehydrogenase SA1924 EC=1.2.1.3 ; NAD Oxidoreductase

Pubmed 15590099

 

prodomImg

pubmed

19

489

S=737 I=37 E=1.85244e-80

Glycine betaine aldehyde dehydrogenase ; Oxidoreductase

Pubmed 15168170

 

prodomImg

pubmed

20

488

S=732 I=36 E=7.47456e-80

Betaine aldehyde dehydrogenase 1 EC=1.2.1.8 ; NAD Oxidoreductase

Pubmed 9141699

 

prodomImg

pubmed

9

489

S=716 I=34 E=7.02028e-78

Aldehyde dehydrogenase 5, mitochondrial EC=1.2.1.3 EC=1.2.1.4 ; Mitochondrion NAD NADP Oxidoreductase Transit peptide

Pubmed 17652520

 

prodomImg

pubmed

9

489

S=715 I=34 E=7.59335e-78

Aldehyde dehydrogenase 5, mitochondrial EC=1.2.1.3 EC=1.2.1.4 ; Mitochondrion NAD NADP Oxidoreductase Transit peptide

Pubmed 9059631

 

prodomImg

sp

20

486

S=755 I=38 E=7.67176e-83

Putative aldehyde dehydrogenase SSP0762 - Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

 

prodomImg

sp

20

486

S=755 I=37 E=8.66775e-83

Putative aldehyde dehydrogenase SH0913 - Staphylococcus haemolyticus (strain JCSC1435)

 

prodomImg

sp

20

486

S=744 I=37 E=1.72456e-81

Putative aldehyde dehydrogenase SAB2006c - Staphylococcus aureus (strain bovine RF122)

 

prodomImg

sp

20

486

S=744 I=37 E=1.84914e-81

Putative aldehyde dehydrogenase MW2046 - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

20

486

S=744 I=37 E=1.84914e-81

Putative aldehyde dehydrogenase SAS2025 - Staphylococcus aureus (strain MSSA476)

 

prodomImg

trembl

1

489

S=2272 I=91 E=0

Aldehyde dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

489

S=2171 I=88 E=0

Aldehyde dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

trembl

1

489

S=2170 I=87 E=0

Aldehyde dehydrogenase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR016162 [G3DSA:3.40.605.10]

16

304

Aldehyde dehydrogenase, N-terminal

Iprscan IPR015590 [PTHR11699]

61

487

Aldehyde dehydrogenase

Iprscan [PTHR11699:SF35]

61

487

-

Iprscan IPR015590 [PF00171]

25

486

Aldehyde dehydrogenase

Iprscan IPR016160 [PS00687]

261

268

Aldehyde dehydrogenase, conserved site

Iprscan IPR016161 [SSF53720]

16

489

Aldehyde/histidinol dehydrogenase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one MnVVtnfh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits