Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0844YP_362575.1putative quinone oxidoreductase

XCV0844
XCV0843
XCV0843
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0845
XCV0845
ID
AC YP_362575.1
LT XCV0844
SY
OR NC_007508 from 963567 to 964544 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative quinone oxidoreductase
IP Alcohol dehydrogenase superfamily, zinc-containing; GroES-like; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 325 aa
 
........10........20........30........40........50
| | | | |
MSDTTMTAIAIRDGKGDAEALYATEQPRPRPAPGQVLIRVHAAGINRPDL
LQRTGHYPPPPGAPETLGLEIAGEIVEPAGRWKVGERVCALLAGGGYAQY
AAVDARHVLPIPAGMDLVHAAALPETIFTAYANLFEHGRLAAGQWLLLHG
ATSGIGVTAIQMAKAAGAHVLATARSASKAAQARELGADVAIDSTTASFV
EVAKAHGGVDVALDMVGAAVFADTLEALNPRGRIVYIASQAGATIEVPIP
VLMRKQAVITGSTLRPRNADEKARLAAEVERVVWPWIEQGKLRVLLDKCF
PLSEAAAAHRYLEQGSHLGKVVLEM
xansp

YP_363901.1 lcl|XCV2170

25

323

S=173 I=28 E=2.27504e-14

putative oxidoreductase

xansp

YP_361916.1 lcl|XCV0185

105

325

S=151 I=29 E=9.24465e-12

putative alcohol dehydrogenase

xansp

YP_364778.1 lcl|XCV3047

20

325

S=151 I=25 E=1.04448e-11

putative alcohol dehydrogenase

xansp

YP_366101.1 lcl|XCV4370

16

323

S=143 I=24 E=9.23693e-11

putative nuclear receptor binding factor-like protein

xansp

YP_362772.1 lcl|XCV1041

17

193

S=132 I=32 E=1.91969e-09

putative oxidoreductase

xansp

YP_362026.1 lcl|XCV0295

128

234

S=115 I=32 E=2.38325e-07

Zinc-containing alcohol dehydrogenase superfamily protein

xansp

YP_364064.1 lcl|XCV2333

105

325

S=104 I=26 E=4.01788e-06

putative Zn-dependent alcohol dehydrogenase

pubmed

13

325

S=438 I=34 E=1.79149e-44

Putative quinone oxidoreductase EC=1.-.-.- ; Acetylation Alternative splicing Polymorphism

Pubmed 9305847,15067011

 

prodomImg

pubmed

81

325

S=349 I=32 E=1.06126e-33

NADH:quinone reductase and related Zn-dependent oxidoreductases

Pubmed 15608629

 

prodomImg

pubmed

3

323

S=317 I=31 E=9.36183e-30

Zeta-crystallin

Pubmed 11371565

 

prodomImg

pubmed

13

325

S=297 I=35 E=2.43866e-27

EpoD ; Phosphopantetheine Transferase

Pubmed 10649995,10831849

 

prodomImg

pubmed

15

322

S=151 I=29 E=9.78617e-10

EpoD ; Phosphopantetheine Transferase

Pubmed 10649995,10831849

 

prodomImg

pubmed

13

325

S=296 I=34 E=3.42629e-27

Polyketide synthase ; Phosphopantetheine Transferase

Pubmed 10662695

 

prodomImg

pubmed

15

322

S=147 I=28 E=3.58758e-09

Polyketide synthase ; Phosphopantetheine Transferase

Pubmed 10662695

 

prodomImg

pubmed

29

325

S=295 I=30 E=3.90501e-27

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm Eye lens protein NADP

Pubmed 2777081,1420281

 

prodomImg

pubmed

27

171

S=289 I=44 E=2.11936e-26

Oxidoreductase

Pubmed 17086451

 

prodomImg

pubmed

29

323

S=286 I=29 E=5.3404e-26

Quinone oxidoreductase EC=1.6.5.5 ; Cytoplasm NADP Polymorphism

Pubmed 8466529,8088825

 

prodomImg

sp

13

325

S=438 I=34 E=1.12865e-44

Putative quinone oxidoreductase - Homo sapiens (Human)

Pubmed 9305847,15067011,17224074,

 

prodomImg

sp

29

325

S=295 I=30 E=2.46017e-27

Quinone oxidoreductase - Cavia porcellus (Guinea pig)

Pubmed 2777081,1420281,1370456,

 

prodomImg

sp

29

323

S=295 I=29 E=2.61499e-27

Quinone oxidoreductase - Rattus norvegicus (Rat)

 

prodomImg

sp

29

323

S=286 I=29 E=3.36446e-26

Quinone oxidoreductase - Homo sapiens (Human)

Pubmed 8466529,8088825,

 

prodomImg

sp

29

323

S=285 I=29 E=3.60751e-26

Quinone oxidoreductase - Mus musculus (Mouse)

Pubmed 8170370,8645260,

 

prodomImg

trembl

1

325

S=1483 I=90 E=3.47486e-170

Quinone reductase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

325

S=1431 I=86 E=6.09374e-164

Quinone reductase - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

325

S=1431 I=86 E=6.09374e-164

Quinone reductase - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

105

300

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

20

325

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan IPR014189 [PTHR11695:SF28]

20

325

Quinone oxidoreductase putative, PIG3

Iprscan IPR013149 [PF00107]

142

281

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

33

111

Alcohol dehydrogenase GroES-like

Iprscan IPR014189 [TIGR02824]

6

325

Quinone oxidoreductase putative, PIG3

Iprscan IPR011032 [SSF50129]

6

146

GroES-like

Iprscan IPR016040 [SSF51735]

119

294

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tqcMpW6p)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

259 hits
swiss-prot

Swiss-Prot ncbi-blastp

67 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits