Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0653pheCYP_362384.1putative carboxycyclohexadienyl dehydratase

pheC XCV0653
XCV0652
XCV0652
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0654
XCV0654
ID pheC
AC YP_362384.1
LT XCV0653
SY
OR NC_007508 from 736184 to 736984 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative carboxycyclohexadienyl dehydratase
IP Bacterial extracellular solute-binding protein, family 3
CL
EC
GO Biological Process: transport (GO:0006810)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: transporter activity (GO:0005215)
PM
AN
SQ 266 aa
 
........10........20........30........40........50
| | | | |
MPRPRRDHAMRHRICLALLLSCGTAHAATPASRLDAVLQSGVLRVCTTGD
YRPYSLLRGDGQFEGSDIDLVQSLAASLDARVRLVRTSWPQLMPDLLADR
CDIAVGGISVTLQRQRQASFSAVLDVDGKIPLVRCADQARYRSLEQLNRP
EVRLIEPPGGTNEAFAHRQLPQATLRLFADNTTIFQELLAHRADVMITDA
SEALYQQARLPGLCAIAPEQPLQYSEKAFLLPRDDHAWKAYVDQWLHLSK
ASGDYQRIVEGWRQPR
pubmed

32

266

S=613 I=51 E=8.03735e-66

Cyclohexadienyl dehydratase EC=4.2.1.51 EC=4.2.1.91 ; Amino-acid biosynthesis Aromatic Lyase Multifunctional enzyme Periplasm Phenylalanine Signa

Pubmed 1733946

 

prodomImg

pubmed

32

141

S=308 I=54 E=8.21131e-29

Cyclohexadienyl dehydratase

Pubmed 17185531

 

prodomImg

pubmed

15

262

S=186 I=24 E=5.15317e-14

FliY (Putative periplasmic binding transport protein)

Pubmed 10411266

 

prodomImg

pubmed

15

262

S=178 I=23 E=4.97239e-13

Cystine-binding periplasmic protein ; Signal Transport

Pubmed 8550423

 

prodomImg

pubmed

15

266

S=176 I=24 E=7.17131e-13

Probable binding protein component of ABC transporter

Pubmed 16581904

 

prodomImg

pubmed

15

262

S=172 I=25 E=2.34727e-12

GlnH-like protein ; Plasmid

Pubmed 12511498

 

prodomImg

pubmed

43

262

S=156 I=23 E=2.24339e-10

Glutamine high-affinity transporter (High-affinity periplasmic glutamine binding protein)

Pubmed 9009317

 

prodomImg

pubmed

43

262

S=153 I=23 E=4.87421e-10

Glutamine-binding periplasmic protein ; Amino-acid transport Signal

Pubmed 3027504

 

prodomImg

pubmed

14

262

S=149 I=26 E=1.43692e-09

Lysine-arginine-ornithine-binding periplasmic protein ; Amino-acid transport Signal

Pubmed 6273842

 

prodomImg

pubmed

15

262

S=140 I=23 E=1.62211e-08

High affinity cystine binding protein

Pubmed 9150229,10094698

 

prodomImg

sp

32

266

S=613 I=51 E=5.12144e-66

Cyclohexadienyl dehydratase precursor [Includes: Prephenate dehydratase - Pseudomonas aeruginosa

Pubmed 1733946,8515238,7604006,

 

prodomImg

sp

15

262

S=178 I=23 E=3.16844e-13

Cystine-binding periplasmic protein precursor - Escherichia coli (strain K12)

Pubmed 8550423,8450713,8774726,

 

prodomImg

sp

15

262

S=178 I=23 E=3.16844e-13

Cystine-binding periplasmic protein precursor - Escherichia coli O6

 

prodomImg

sp

43

262

S=153 I=23 E=3.10588e-10

Glutamine-binding periplasmic protein precursor - Escherichia coli (strain K12)

Pubmed 3027504,8831790,9571045,

 

prodomImg

sp

43

262

S=153 I=23 E=3.10588e-10

Glutamine-binding periplasmic protein precursor - Escherichia coli O6

 

prodomImg

trembl

1

266

S=1343 I=96 E=2.27996e-153

Cyclohexadienyl dehydratase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

10

262

S=1075 I=85 E=7.20277e-121

Cyclohexadienyl dehydratase - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

10

262

S=1075 I=85 E=7.20277e-121

Cyclohexadienyl dehydratase - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan [G3DSA:3.40.190.10]

38

148

-

Iprscan IPR001638 [PF00497]

43

265

Bacterial extracellular solute-binding protein, family 3

Iprscan IPR001638 [SM00062]

42

266

Bacterial extracellular solute-binding protein, family 3

Iprscan [SignalP-NN(euk)]

1

27

-

Iprscan [SSF53850]

38

262

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nHXKN7Ab)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits