Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0413YP_362144.1hypothetical protein

XCV0413
XCV0412
XCV0412
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0414
XCV0414
ID
AC YP_362144.1
LT XCV0413
SY
OR NC_007508 from 465927 to 466202 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE hypothetical protein
IP
CL
EC
GO
PM
AN
SQ 91 aa
 
........10........20........30........40........50
| | | | |
MMAFPEVILPLAARELGGEEVVMLLSLQEQLLTEYGWRLTLSDLGLLCVC
PLLLVRTPEEVAAALDRGQVVARVVLDALATQVDTAKEVAS
xansp

YP_364674.1 lcl|XCV2943

3

88

S=268 I=65 E=7.77103e-27

hypothetical protein

pubmed

1

91

S=345 I=80 E=3.96166e-34

Hpa3

Pubmed 15986924

 

prodomImg

pubmed

1

91

S=336 I=78 E=4.47225e-33

Hpa3

Pubmed 16957248

 

prodomImg

trembl

1

91

S=345 I=80 E=3.0609e-33

Putative uncharacterized protein XOO0104 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

1

91

S=345 I=80 E=3.0609e-33

Hpa3 - Xanthomonas oryzae pv. oryzae

Pubmed 15986924,

 

prodomImg

trembl

1

91

S=345 I=80 E=3.48856e-33

Hpa3 - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one c7vigOPx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
trembl

TrEMBL ncbi-blastp

9 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits