Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0316YP_362047.1putative nucleoside hydrolase

XCV0316
XCV0315
XCV0315
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0317
XCV0317
ID
AC YP_362047.1
LT XCV0316
SY
OR NC_007508 from 361780 to 362949 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative nucleoside hydrolase
IP Inosine/uridine-preferring nucleoside hydrolase
CL
EC
GO
PM
AN
SQ 389 aa
 
........10........20........30........40........50
| | | | |
MPLSIAVATPSTFHDKNAMNDPHRPSSRRRVILEDDIDGFTPAQLLLLQS
PDVQVLGISAVSGNIWRDEALAHTCRLLELAGHPQIPVLPGPVHPLLNSE
SATERWEALYGKLVWKGAWTRHWVDGDTVQSAPRYHAHDVVPELALGNPS
VVRPADEPAALFMLRMVRQYPGEVSIIATGPLTNLALAQSLDPSFATLAR
ELVYMGGSLNPRQQRNSVSAQQFAREFVNSPRREFNIRWDPEAASIVMRA
PWRQITMVPVDPSTATELTTELLARMSAADTTIGHALRRREPGFPMWDEL
ATAVWLRPDLATRTETLYVDTNTAFDAGYGDILSWAPGYQPGLGEQAQTV
VHAVDVPAFEQLLVDRLTAPQPPAVGLPLPLFPIGPRSP
xansp

YP_362893.1 lcl|XCV1162

162

263

S=120 I=37 E=7.41488e-08

putative inosine-uridine preferring nucleoside hydrolase

xansp

YP_365238.1 lcl|iunH-XCV3507

132

248

S=99 I=37 E=2.01756e-05

inosine-uridine preferring nucleoside hydrolase

pubmed

27

261

S=171 I=30 E=5.0672e-12

Putative inosine-uridine preferring nucleoside hydrolase EC=3.2.2.1 ; Glycosidase

Pubmed 16204499

 

prodomImg

pubmed

128

261

S=150 I=33 E=2.0771e-09

Nucleoside hydrolase

Pubmed 16707707

 

prodomImg

pubmed

156

259

S=136 I=37 E=9.88276e-08

Putative purine hydrolase (Salivary purine nucleosidase)

Pubmed 12213246,12459196

 

prodomImg

pubmed

171

281

S=125 I=33 E=2.26065e-06

Inosine-uridine preferring nucleoside hydrolase EC=3.2.2.- ; Calcium Glycosidase Metal-binding Nucleotide metabolism

Pubmed 8634237,8634238

 

prodomImg

sp

23

369

S=324 I=27 E=8.83296e-31

Uncharacterized protein C800.11 precursor - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

153

367

S=137 I=28 E=4.20228e-08

Uncharacterized protein C1683.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

171

281

S=125 I=33 E=1.42309e-06

Inosine-uridine preferring nucleoside hydrolase - Crithidia fasciculata

Pubmed 8634237,8634238,

 

prodomImg

sp

46

210

S=119 I=25 E=7.59e-06

Uncharacterized protein in bps2 5'region - Acidianus ambivalens (Desulfurolobus ambivalens)

 

prodomImg

trembl

1

389

S=1856 I=92 E=0

Nucleoside hydrolase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

19

385

S=1665 I=87 E=0

Purine nucleosidase - Xanthomonas campestris pv. campestris (strain B100)

 

prodomImg

trembl

19

385

S=1661 I=87 E=0

Nucleoside hydrolase - Xanthomonas campestris pv. campestris

 

prodomImg

Iprscan [PD007736]

45

247

-

Iprscan IPR001910 [G3DSA:3.90.245.10]

15

370

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

153

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

27

128

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PTHR12304]

27

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [PF01156]

28

371

Inosine/uridine-preferring nucleoside hydrolase

Iprscan IPR001910 [SSF53590]

28

373

Inosine/uridine-preferring nucleoside hydrolase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9cuEXGNo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
trembl

TrEMBL ncbi-blastp

188 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits