Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0185YP_361916.1putative alcohol dehydrogenase

XCV0185
XCV0184
XCV0184
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0186
XCV0186
ID
AC YP_361916.1
LT XCV0185
SY
OR NC_007508 from 220993 to 221946 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; NAD(P)-binding
CL
EC
GO Biological Process: metabolic process (GO:0008152)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
PM
AN
SQ 317 aa
 
........10........20........30........40........50
| | | | |
MPEPVAGPGEVIVAPRLVGLINRDLQILKGTYGGKLAPTRVPVAEGVGIV
TSVGAGVGQVAPGDRVVSGHFPTWLEGRFDAEMFAHDLGVTHDGWLAEKV
SLPASALIKVPASLEDEDVAALASAAVTAWNALVDVARIKAGDLVLCLGT
GGVSMAALQLAKLHGARVAITSSSDDKLELARRLGADITVNYRTHPDWAE
AVVQLSGGGVDVIIETGGQDTLGQSIKAAAANATIVVIGVTPGASSPIPD
YVALIRKNVTIRGIANGSRAMFVDLLRAIEQHRIKTLHSKTFRFDEAPQA
LDYFAKAQHVGKVLIRL
xansp

YP_364778.1 lcl|XCV3047

1

317

S=446 I=37 E=1.42702e-47

putative alcohol dehydrogenase

xansp

YP_362575.1 lcl|XCV0844

94

317

S=179 I=29 E=3.44049e-15

putative quinone oxidoreductase

xansp

YP_364064.1 lcl|XCV2333

2

238

S=138 I=26 E=3.48642e-10

putative Zn-dependent alcohol dehydrogenase

xansp

YP_362783.1 lcl|tdh-XCV1052

1

272

S=134 I=27 E=1.10204e-09

L-threonine 3-dehydrogenase

xansp

YP_365597.1 lcl|XCV3866

84

232

S=117 I=31 E=1.1002e-07

Zn-dependent dehydrogenase

xansp

YP_363901.1 lcl|XCV2170

94

315

S=113 I=22 E=3.3585e-07

putative oxidoreductase

xansp

YP_362519.1 lcl|XCV0788

79

219

S=109 I=25 E=1.242e-06

putative alcohol dehydrogenase class III

xansp

YP_366101.1 lcl|XCV4370

2

74

S=99 I=35 E=1.82123e-05

putative nuclear receptor binding factor-like protein

pubmed

2

317

S=421 I=32 E=2.12776e-42

Zinc-binding alcohol dehydrogenase (NADPH:quinone reductase or related Zn-dependent oxidoreductase)

Pubmed 18004300

 

prodomImg

pubmed

142

315

S=298 I=45 E=1.90911e-27

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

1

263

S=246 I=33 E=3.2332e-21

Putative uncharacterized protein

Pubmed 12019272

 

prodomImg

pubmed

4

317

S=243 I=29 E=7.93674e-21

Alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15152088

 

prodomImg

pubmed

3

317

S=242 I=27 E=1.01313e-20

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 1735726,4578954

 

prodomImg

pubmed

1

317

S=234 I=27 E=8.28347e-20

Glucosaminitol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11831851

 

prodomImg

pubmed

3

317

S=232 I=27 E=1.76863e-19

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8020473

 

prodomImg

pubmed

9

317

S=229 I=28 E=3.94454e-19

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

Pubmed 8049268

 

prodomImg

pubmed

3

317

S=227 I=27 E=7.13639e-19

Thermostable alcohol dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 18436321

 

prodomImg

pubmed

1

315

S=221 I=28 E=3.42807e-18

6-hydroxycylohex-1-ene-1-carboxyl-CoA dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 15997700

 

prodomImg

sp

7

317

S=476 I=38 E=2.75564e-49

Zinc-type alcohol dehydrogenase-like protein C1773.06c - Schizosaccharomyces pombe (Fission yeast)

 

prodomImg

sp

3

317

S=242 I=27 E=6.43751e-21

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 1735726,4578954,436831,8049268,

 

prodomImg

sp

3

317

S=232 I=27 E=1.12381e-19

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8020473,

 

prodomImg

sp

9

317

S=229 I=28 E=2.5064e-19

Alcohol dehydrogenase - Bacillus stearothermophilus (Geobacillus stearothermophilus)

Pubmed 8049268,

 

prodomImg

sp

1

280

S=218 I=29 E=5.53681e-18

Alcohol dehydrogenase - Rhizobium meliloti (Sinorhizobium meliloti)

Pubmed 9659380,11481432,

 

prodomImg

trembl

1

317

S=1473 I=92 E=4.65826e-169

Alcohol dehydrogenase - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

135

317

S=822 I=87 E=3.50679e-90

Putative uncharacterized protein XOO4231 - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

trembl

135

317

S=822 I=87 E=3.50679e-90

Alcohol dehydrogenase - Xanthomonas oryzae pv. oryzae PXO99A

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

104

292

NAD(P)-binding

Iprscan IPR002085 [PTHR11695]

1

317

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan [PTHR11695:SF21]

1

317

-

Iprscan [PTHR11695:SF21]

1

71

-

Iprscan [PTHR11695:SF21]

92

317

-

Iprscan IPR013149 [PF00107]

141

281

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

8

110

Alcohol dehydrogenase GroES-like

Iprscan IPR011032 [SSF50129]

1

158

GroES-like

Iprscan IPR016040 [SSF51735]

114

286

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TeVYecB4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

246 hits
swiss-prot

Swiss-Prot ncbi-blastp

219 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits