Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0080YP_361811.1putative thioredoxin

XCV0080
XCV0079
XCV0079
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0081
XCV0081
ID
AC YP_361811.1
LT XCV0080
SY
OR NC_007508 from 92935 to 93264 on strand +
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE putative thioredoxin
IP Thioredoxin-like fold; Thioredoxin domain
CL
EC
GO Biological Process: cell redox homeostasis (GO:0045454)
PM
AN
SQ 109 aa
 
........10........20........30........40........50
| | | | |
MGFVRQYATQAPERSAVEAQTGLQVLEFGTDWCGHCIAAQPLLQKLLGGY
EAIDYRKIEDGKGRPLGRSFRVKLWPTIILLRDGQELARAVRPQTREDLQ
DLLSLLDAA
xansp

YP_364671.1 lcl|XCV2940

25

85

S=105 I=31 E=6.98377e-07

thioredoxin

xansp

YP_365686.1 lcl|trxA-XCV3955

6

85

S=97 I=32 E=5.81046e-06

thioredoxin

xansp

YP_363058.1 lcl|XCV1327

13

89

S=90 I=28 E=4.79231e-05

putative thioredoxin

pubmed

4

91

S=130 I=31 E=4.35933e-08

Thioredoxin-1 ; Cytoplasm Deoxyribonucleotide synthesis Electron transport Golgi apparatus Membrane Nucleus Phosphoprotein Redox-active center

Pubmed 1988444,2026619

 

prodomImg

pubmed

21

91

S=127 I=31 E=1.00676e-07

Thioredoxin H

Pubmed 16354655

 

prodomImg

pubmed

1

97

S=124 I=32 E=2.64988e-07

Thioredoxin ; Electron transport Redox-active center

Pubmed 14702300

 

prodomImg

pubmed

1

97

S=124 I=32 E=2.64988e-07

Thioredoxin ; Electron transport Redox-active center

Pubmed 15590099

 

prodomImg

pubmed

1

97

S=124 I=32 E=2.64988e-07

Thioredoxin ; Electron transport Redox-active center

Pubmed 14702300

 

prodomImg

pubmed

23

97

S=123 I=27 E=3.53331e-07

Thioredoxin h

Pubmed 12857849

 

prodomImg

pubmed

23

97

S=119 I=31 E=9.79946e-07

Thioredoxin 3

Pubmed 17041024

 

prodomImg

pubmed

17

97

S=118 I=23 E=1.38887e-06

Thioredoxin H-type 2 ; Cytoplasm Electron transport Redox-active center

Pubmed 7777559,8642611

 

prodomImg

pubmed

21

91

S=117 I=27 E=1.71214e-06

Thioredoxin

Pubmed 16299179

 

prodomImg

pubmed

20

91

S=116 I=32 E=2.57932e-06

Thioredoxin

Pubmed 16672467

 

prodomImg

sp

4

91

S=130 I=31 E=2.90455e-08

Thioredoxin-1 - Saccharomyces cerevisiae (Baker's yeast)

Pubmed 1988444,2026619,1561834,7961686,4945270,3060034,9015301,9657146,10681558,9988687,12410842,12437921,11018134,11169096,12914955,

 

prodomImg

sp

21

97

S=126 I=33 E=8.78953e-08

Thioredoxin - Chlamydia pneumoniae (Chlamydophila pneumoniae)

 

prodomImg

sp

1

97

S=124 I=32 E=1.76557e-07

Thioredoxin - Staphylococcus aureus (strain MW2)

 

prodomImg

sp

1

97

S=124 I=32 E=1.76557e-07

Thioredoxin - Staphylococcus aureus

Pubmed 14702300,

 

prodomImg

sp

1

97

S=124 I=32 E=1.76557e-07

Thioredoxin - Staphylococcus aureus (strain MSSA476)

 

prodomImg

trembl

1

97

S=488 I=95 E=1.63577e-50

Thioredoxin - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

97

S=460 I=88 E=3.57618e-47

Thioredoxin - Xanthomonas campestris pv. campestris

 

prodomImg

trembl

1

97

S=460 I=88 E=3.57618e-47

Thioredoxin - Xanthomonas campestris pv. campestris (strain 8004)

 

prodomImg

Iprscan IPR006662 [PR00421]

24

32

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

32

41

Thioredoxin-like subdomain

Iprscan IPR006662 [PR00421]

71

82

Thioredoxin-like subdomain

Iprscan IPR012335 [G3DSA:3.40.30.10]

20

107

Thioredoxin fold

Iprscan IPR015467 [PTHR10438]

14

104

Thioredoxin, core

Iprscan IPR013766 [PF00085]

11

105

Thioredoxin domain

Iprscan IPR017936 [PS51352]

5

109

Thioredoxin-like

Iprscan IPR012336 [SSF52833]

4

106

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one avIaB5RP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
trembl

TrEMBL ncbi-blastp

120 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits