Xanthomonas campestris pv. vesicatoria str. 85-10

  1. XCV0020fadLYP_361751.1FadL family outer membrane protein

fadL XCV0020
XCV0019
XCV0019
Cluster
DrawMap
Print Version

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Remora
Multalin
XCV0021
XCV0021
ID fadL
AC YP_361751.1
LT XCV0020
SY
OR NC_007508 from 21039 to 22379 on strand -
OS Xanthomonas campestris pv. vesicatoria str. 85-10
DE FadL family outer membrane protein
IP Membrane protein involved in aromatic hydrocarbon degradation
CL
EC
GO
PM
AN
SQ 446 aa
 
........10........20........30........40........50
| | | | |
MSTASTLSRATLLAVGIAGVLAVGQAHGAAFQLKENSAKGLGRAFAGSGS
APDDASIIANNPAGMRQLDGRLFQADVSAISFSAKFQPDTAAYANGAPVS
GGNGGDAGMIAPVPAMYFHVPFGENDNMHLGTSLTVPFGFKTEYDRDWVG
RYHGTKTELQAIDFNVAFSYDVNPYVSFGASVFAERLDIDLANAVDFGSV
LAARRVPGFAPGSADGYSRIKGDSTEVGFTLGGLFSIDENTHIGFSYRSQ
VEHKITDGTADFTVPGSAAAVLGVAAPGTFVDTKGRATVKLPASATASFT
HNVNEQWSIMADVTRTAWSKFDQVTVDFASNQPDSVLDFSYRDTTFASIG
ADYRMSDTVTLRGGLAYDQTPTTAEHRDVRVPDASRKWVSLGMSWRPSAQ
TEYNFGYTHLFTSDPTSDTRSATGDRLAGSYDVKGDVLAASINYKF
pubmed

3

395

S=404 I=32 E=3.46013e-40

Outer membrane protein FadL

Pubmed 11097912

 

prodomImg

pubmed

7

446

S=398 I=29 E=1.84545e-39

Putative outer membrane protein

Pubmed 11207749,11872725

 

prodomImg

pubmed

3

395

S=391 I=31 E=1.35897e-38

Long-chain fatty acid transport protein

Pubmed 15292145

 

prodomImg

pubmed

56

446

S=374 I=27 E=1.53284e-36

Putative outer membrane protein NMB0088 ; Cell Signal Transmembrane

Pubmed 17038831

 

prodomImg

pubmed

31

410

S=361 I=29 E=6.5117e-35

Outer membrane protein ; Signal

Pubmed 2572549

 

prodomImg

pubmed

31

410

S=357 I=29 E=1.66969e-34

Outer membrane protein P1

Pubmed 10899849

 

prodomImg

pubmed

11

410

S=351 I=28 E=1.04184e-33

Outer membrane protein P1

Pubmed 10899849

 

prodomImg

pubmed

31

410

S=349 I=29 E=1.5559e-33

Outer membrane protein P1

Pubmed 10899849

 

prodomImg

pubmed

31

410

S=348 I=28 E=2.16705e-33

Outer membrane protein P1

Pubmed 10899849

 

prodomImg

pubmed

31

410

S=348 I=29 E=2.40606e-33

Outer membrane protein P1

Pubmed 10899849

 

prodomImg

sp

3

395

S=390 I=31 E=1.03636e-38

Long-chain fatty acid transport protein precursor - Escherichia coli O6

 

prodomImg

sp

31

410

S=371 I=29 E=2.56202e-36

47 kDa outer membrane protein precursor - Pasteurella multocida

 

prodomImg

sp

6

410

S=343 I=29 E=5.74962e-33

Long-chain fatty acid transport protein precursor - Salmonella typhi

 

prodomImg

sp

6

395

S=343 I=29 E=6.61033e-33

Long-chain fatty acid transport protein precursor - Salmonella typhimurium

 

prodomImg

sp

31

410

S=335 I=29 E=4.78366e-32

Outer membrane protein P1 precursor - Haemophilus influenzae

Pubmed 10675023,

 

prodomImg

trembl

1

446

S=2318 I=99 E=0

Outer membrane protein - Xanthomonas axonopodis pv. citri

 

prodomImg

trembl

1

446

S=2244 I=98 E=0

Outer membrane protein - Xanthomonas oryzae pv. oryzae

 

prodomImg

trembl

1

446

S=2241 I=98 E=0

Outer membrane protein - Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

 

prodomImg

Iprscan IPR005017 [PF03349]

19

446

Membrane protein involved in aromatic hydrocarbon degradation

Iprscan [SignalP-NN(euk)]

1

28

-

Iprscan [tmhmm]

7

29

-

Iprscan [SSF56935]

29

446

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one V8sbuotM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

60 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
trembl

TrEMBL ncbi-blastp

0 hits
xanc5

Xanthomonas campestris pv. vesicatoria str. 85-10 proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits